Pimephales promelas (fathead minnow): 120490889 Help Entry 120490889         CDS       T08155                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism pprm  Pimephales promelas (fathead minnow) Pathway pprm04145   Phagocytosis pprm04517   IgSF CAM signaling pprm04814   Motor proteins pprm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pprm00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     120490889 (dynll2b)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     120490889 (dynll2b)   09142 Cell motility    04814 Motor proteins     120490889 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120490889 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pprm03037]     120490889 (dynll2b)    04812 Cytoskeleton proteins [BR:pprm04812]     120490889 (dynll2b) Cilium and associated proteins [BR:pprm03037]  Motile cilia and associated proteins   Dynein arm    120490889 (dynll2b) Cytoskeleton proteins [BR:pprm04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      120490889 (dynll2b) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  120490889 NCBI-ProteinID:  XP_039544339 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggcagtaataaagaacgctgatatgtctgaggacatgcagcaggat gcagtggattgtgccacacaggccatggagaagtacaatattgagaaagacattgctgca tatatcaaaaaggagtttgataagaagtataatccaacatggcattgtattgtgggacgg aactttggcagttacgtgacgcatgaaaccaagcatttcatctacttttacttgggtcaa gtagccattctactcttcaaatcgggctga

DBGET integrated database retrieval system