Pimephales promelas (fathead minnow): 120493692 Help Entry 120493692         CDS       T08155                                  Symbol rhoca Name (RefSeq) ras homolog family member Ca   KO K04513   Ras homolog gene family, member A Organism pprm  Pimephales promelas (fathead minnow) Pathway pprm04081   Hormone signaling pprm04144   Endocytosis pprm04150   mTOR signaling pathway pprm04270   Vascular smooth muscle contraction pprm04310   Wnt signaling pathway pprm04350   TGF-beta signaling pathway pprm04510   Focal adhesion pprm04517   IgSF CAM signaling pprm04519   Cadherin signaling pprm04520   Adherens junction pprm04530   Tight junction pprm04621   NOD-like receptor signaling pathway pprm04625   C-type lectin receptor signaling pathway pprm04810   Regulation of actin cytoskeleton pprm05100   Bacterial invasion of epithelial cells pprm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pprm00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     120493692 (rhoca)    04350 TGF-beta signaling pathway     120493692 (rhoca)    04150 mTOR signaling pathway     120493692 (rhoca)   09133 Signaling molecules and interaction    04081 Hormone signaling     120493692 (rhoca)    04517 IgSF CAM signaling     120493692 (rhoca)    04519 Cadherin signaling     120493692 (rhoca)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120493692 (rhoca)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120493692 (rhoca)    04520 Adherens junction     120493692 (rhoca)    04530 Tight junction     120493692 (rhoca)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120493692 (rhoca)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120493692 (rhoca)    04625 C-type lectin receptor signaling pathway     120493692 (rhoca)   09153 Circulatory system    04270 Vascular smooth muscle contraction     120493692 (rhoca)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120493692 (rhoca)    05100 Bacterial invasion of epithelial cells     120493692 (rhoca)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pprm04131]     120493692 (rhoca)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pprm04147]     120493692 (rhoca)    04031 GTP-binding proteins [BR:pprm04031]     120493692 (rhoca) Membrane trafficking [BR:pprm04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     120493692 (rhoca) Exosome [BR:pprm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120493692 (rhoca)   Exosomal proteins of other body fluids (saliva and urine)    120493692 (rhoca)   Exosomal proteins of colorectal cancer cells    120493692 (rhoca)   Exosomal proteins of bladder cancer cells    120493692 (rhoca) GTP-binding proteins [BR:pprm04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     120493692 (rhoca) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  120493692 NCBI-ProteinID:  XP_039548387 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELTKMKQEPVKPEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAALQ VRKRKKRNGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgctatcaggaagaagctggtgatcgtgggagatggagcatgtgggaagacctgt ctactcatagtgttcagcaaagatcagtttccagaagtctacgtgccgactgtgttcgag aactacattgcagatatcgaagtcgacagcaaacaggtggagctggctttgtgggacaca gcaggacaggaagactatgatcgcctgagacctctgtcttacccagacacagatgtaatt ctcatgtgtttctccatagacagtcccgacagtttagagaatatcccagaaaagtggacg ccagaggtgaagcacttctgccccaacgttcccataatcctcgtgggcaataagaaagat ctgcggaacgacgagcacacacggagagagctgactaagatgaagcaggagccggttaaa cctgaggagggcagagacatggccaaccgtattagcgcctttggatacctggaatgctca gccaagactaaggagggcgtgagggaggtattcgaaatggccaccagggcggcgctgcaa gtccgcaagaggaagaagaggaatgggtgcttgctgttgtaa

DBGET integrated database retrieval system