Pseudomonas protegens Cab57: PPC_0491 Help Entry PPC_0491          CDS       T03613                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppro  Pseudomonas protegens Cab57 Pathway ppro00998   Biosynthesis of various antibiotics ppro01100   Metabolic pathways ppro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PPC_0491    00074 Mycolic acid biosynthesis     PPC_0491   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PPC_0491 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ALIX_LYPXL_bnd DUF7080 Motif Other DBs NCBI-ProteinID:  BAO59838 LinkDB All DBs Position complement(547653..547907) Genome browser AA seq 84 aa AA seqDB search MQTRDDIFNTLRDALVELFELEPERVSLESNLYEDLEIDSIDAVDLIDHIKRQTGKKIAA EEFKSVRTVNDVVEAVYRLVQPAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaacccgtgacgatatcttcaacaccctgcgcgatgccctggtcgagctcttcgaa ctggagcccgagcgcgtcagcctcgagtccaacctgtacgaagacctggaaatcgacagc atcgatgcggtcgacctgatcgaccacatcaagcgccagaccggcaagaaaatcgccgcc gaggaattcaagtcggtgcgcaccgtcaacgacgtggtcgaggcggtctaccgtctggtc cagccggccgcatga

DBGET integrated database retrieval system