Pseudomonas protegens Cab57: PPC_0492 Help Entry PPC_0492          CDS       T03613                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppro  Pseudomonas protegens Cab57 Pathway ppro00998   Biosynthesis of various antibiotics ppro01100   Metabolic pathways ppro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PPC_0492   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PPC_0492 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BAO59839 LinkDB All DBs Position complement(547917..548189) Genome browser AA seq 90 aa AA seqDB search MSDTHPDLMLEIKLLIIDALGLEDISAQDIGNDQTLFGEGLGLDSVDALELGLAIQKKYG IKIDADAKDTRNHFSNVASLAAFVTAKQAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagcgatacacacccggacctgatgcttgaaatcaaactgttgatcatcgacgccctg ggcctcgaagacatcagtgcccaggacatcggcaacgaccagacgctgttcggcgaaggc ctcggcctggactcggtggatgccctggagctgggcctggcgatccagaagaagtacggc atcaagatcgacgccgacgccaaggacacccgcaaccacttcagcaacgtggcgagcctt gcggcgttcgtcactgcaaaacaggcagcttga

DBGET integrated database retrieval system