Pseudomonas protegens Cab57: PPC_1845 Help Entry PPC_1845          CDS       T03613                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppro  Pseudomonas protegens Cab57 Pathway ppro00998   Biosynthesis of various antibiotics ppro01100   Metabolic pathways ppro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PPC_1845 (acpP)    00074 Mycolic acid biosynthesis     PPC_1845 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PPC_1845 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  BAO61192 LinkDB All DBs Position 2023197..2023433 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgctgagcaactgggcgttaaagaa gaagaagttgttaacaccgcttccttcgttgaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagct gaaaagatcactaccgttcaagcagctatcgactacgttaccagccaccaggcttaa

DBGET integrated database retrieval system