Pseudomonas protegens Cab57: PPC_5918 Help Entry PPC_5918          CDS       T03613                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism ppro  Pseudomonas protegens Cab57 Brite KEGG Orthology (KO) [BR:ppro00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppro03036]     PPC_5918 Chromosome and associated proteins [BR:ppro03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PPC_5918 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 ZapB ADIP Motif Other DBs NCBI-ProteinID:  BAO65265 LinkDB All DBs Position 6540321..6540530 Genome browser AA seq 69 aa AA seqDB search MEDTDLHALMARLELLITRVEQLKSQNALLLAQEKTWREERAHLIEKNEIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcacgcactgatggccagactcgaactgcttattacccgggtc gagcaactaaagagtcaaaacgcactcttattagctcaggaaaagacctggcgcgaggaa cgcgcgcacctcattgaaaaaaacgaaatcgcccggcgtaaggtcgaatcgatgatttcg cgcctcaaggccctggagcaagactcatga

DBGET integrated database retrieval system