Paenibacillus protaetiae: ET464_06925 Help Entry ET464_06925       CDS       T06829                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pprt  Paenibacillus protaetiae Brite KEGG Orthology (KO) [BR:pprt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pprt03032]     ET464_06925    03036 Chromosome and associated proteins [BR:pprt03036]     ET464_06925    03400 DNA repair and recombination proteins [BR:pprt03400]     ET464_06925 DNA replication proteins [BR:pprt03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ET464_06925 Chromosome and associated proteins [BR:pprt03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ET464_06925 DNA repair and recombination proteins [BR:pprt03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ET464_06925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 DUF2267 Rpf1_C HU-CCDC81_euk_1 HU-DNA_bdg Glycos_trans_3N Motif Other DBs NCBI-ProteinID:  QAY66169 UniProt:  A0A4P6EWQ5 LinkDB All DBs Position complement(1549128..1549403) Genome browser AA seq 91 aa AA seqDB search MNKTELIAKVAELTDLSKKDATKAVDAVFDAISDALQSGDKVQLVGFGNFEVRERQARKG RNPQTGEEIDIAASKMPAFKPGKSLKDLVSN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagaattgattgcaaaagtagcagagctgacagacttgtccaaaaaagac gcaacaaaagcggttgacgctgtatttgatgcgatctcagacgctcttcaaagcggtgac aaagtgcagcttgtcggattcggaaacttcgaggttcgcgagcgtcaagcgcgcaaaggc cgcaacccgcaaacgggtgaagaaattgatattgcagcaagcaagatgcctgctttcaaa ccagggaaatccttgaaagatctcgtatctaattaa

DBGET integrated database retrieval system