Paenibacillus protaetiae: ET464_15640 Help Entry ET464_15640       CDS       T06829                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pprt  Paenibacillus protaetiae Pathway pprt00998   Biosynthesis of various antibiotics pprt01100   Metabolic pathways pprt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pprt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ET464_15640 (acpP)    00074 Mycolic acid biosynthesis     ET464_15640 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ET464_15640 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 CheR_N PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QAY67602 UniProt:  A0A4P6EX44 LinkDB All DBs Position 3381577..3381831 Genome browser AA seq 84 aa AA seqDB search MGGTTDKGQLVNKVRELVHQQLGIDLSELADDKHFVDDYGADSLDLTELVITVEDEFGIS IPESELGDMNTVISIVNYILQQQK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt gtgggaggaacaacggataaaggacagctggtgaacaaagtaagggagctggtccaccag cagcttggcattgatctgtcagaactggccgacgacaaacattttgtcgatgattacggc gcggattcgcttgacctgacggaactcgtcattacggtagaagacgaattcgggattagc attcccgaatccgagttgggagatatgaacacggtcatatccatcgttaactacattttg cagcaacaaaaatag

DBGET integrated database retrieval system