Paenibacillus protaetiae: ET464_16285 Help Entry ET464_16285       CDS       T06829                                  Symbol atpE Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism pprt  Paenibacillus protaetiae Pathway pprt00190   Oxidative phosphorylation pprt01100   Metabolic pathways Module pprt_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pprt00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ET464_16285 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pprt00194]     ET464_16285 (atpE) Photosynthesis proteins [BR:pprt00194]  Photosystem and electron transport system   F-type ATPase [OT]    ET464_16285 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QAY67707 UniProt:  A0A4P6F3H3 LinkDB All DBs Position 3519934..3520146 Genome browser AA seq 70 aa AA seqDB search MSILAAAVAVGLGAIGAGVGNGLIIGRTVEGIARQPELQGKLQTTMFIGVGIVEVVPIIA VVIGFLAYFS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagtatattggcagcagcagtagcagtaggtttgggcgcaatcggcgccggcgtaggt aacggtcttattatcggcagaacggttgaaggtatcgctcgtcaaccagaactgcaaggc aaactccaaacgacgatgtttatcggcgttggtatcgtcgaggttgttccgatcatcgcg gtcgttatcggcttcttggcgtatttcagctaa

DBGET integrated database retrieval system