Pan paniscus (bonobo): 100968258 Help Entry 100968258         CDS       T02283                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5 isoform X1   KO K12499   C-C motif chemokine 5 Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04061   Viral protein interaction with cytokine and cytokine receptor pps04062   Chemokine signaling pathway pps04620   Toll-like receptor signaling pathway pps04621   NOD-like receptor signaling pathway pps04623   Cytosolic DNA-sensing pathway pps04668   TNF signaling pathway pps05020   Prion disease pps05142   Chagas disease pps05163   Human cytomegalovirus infection pps05164   Influenza A pps05168   Herpes simplex virus 1 infection pps05323   Rheumatoid arthritis pps05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     100968258 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100968258 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     100968258 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100968258 (CCL5)    04621 NOD-like receptor signaling pathway     100968258 (CCL5)    04623 Cytosolic DNA-sensing pathway     100968258 (CCL5)    04062 Chemokine signaling pathway     100968258 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     100968258 (CCL5)    05168 Herpes simplex virus 1 infection     100968258 (CCL5)    05163 Human cytomegalovirus infection     100968258 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     100968258 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     100968258 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     100968258 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100968258 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100968258 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:pps00536]     100968258 (CCL5) Cytokines and neuropeptides [BR:pps04052]  Cytokines   Chemokines    100968258 (CCL5) Glycosaminoglycan binding proteins [BR:pps00536]  Heparan sulfate / Heparin   Chemokines    100968258 (CCL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  100968258 NCBI-ProteinID:  XP_003818023 Ensembl:  ENSPPAG00000043880 UniProt:  A0A2R9CSX1 LinkDB All DBs Position 19:28596811..28605632 Genome browser AA seq 91 aa AA seqDB search MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP AVVFVTRKNRQVCANPEKKWVREYINSLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcggcagccctcgctgtcatcctcattgctactgccctctgcgctcct gcatctgcctccccatattcctcggacaccacaccctgctgctttgcctacattgcccgc ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca gcagtcgtctttgtcacccgaaagaaccgccaagtgtgtgccaacccagagaagaaatgg gttcgggagtacatcaactctttggagatgagctag

DBGET integrated database retrieval system