Pan paniscus (bonobo): 100969387 Help Entry 100969387         CDS       T02283                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism pps  Pan paniscus (bonobo) Pathway pps04010   MAPK signaling pathway pps04014   Ras signaling pathway pps04015   Rap1 signaling pathway pps04022   cGMP-PKG signaling pathway pps04066   HIF-1 signaling pathway pps04068   FoxO signaling pathway pps04072   Phospholipase D signaling pathway pps04081   Hormone signaling pps04114   Oocyte meiosis pps04140   Autophagy - animal pps04150   mTOR signaling pathway pps04151   PI3K-Akt signaling pathway pps04152   AMPK signaling pathway pps04211   Longevity regulating pathway pps04213   Longevity regulating pathway - multiple species pps04810   Regulation of actin cytoskeleton pps04910   Insulin signaling pathway pps04911   Insulin secretion pps04913   Ovarian steroidogenesis pps04914   Progesterone-mediated oocyte maturation pps04917   Prolactin signaling pathway pps04923   Regulation of lipolysis in adipocytes pps04930   Type II diabetes mellitus pps04931   Insulin resistance pps04932   Non-alcoholic fatty liver disease pps04940   Type I diabetes mellitus pps04950   Maturity onset diabetes of the young pps04960   Aldosterone-regulated sodium reabsorption pps05010   Alzheimer disease pps05215   Prostate cancer pps05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100969387 (INS)    04014 Ras signaling pathway     100969387 (INS)    04015 Rap1 signaling pathway     100969387 (INS)    04066 HIF-1 signaling pathway     100969387 (INS)    04068 FoxO signaling pathway     100969387 (INS)    04072 Phospholipase D signaling pathway     100969387 (INS)    04022 cGMP-PKG signaling pathway     100969387 (INS)    04151 PI3K-Akt signaling pathway     100969387 (INS)    04152 AMPK signaling pathway     100969387 (INS)    04150 mTOR signaling pathway     100969387 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     100969387 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100969387 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     100969387 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100969387 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     100969387 (INS)    04910 Insulin signaling pathway     100969387 (INS)    04923 Regulation of lipolysis in adipocytes     100969387 (INS)    04913 Ovarian steroidogenesis     100969387 (INS)    04914 Progesterone-mediated oocyte maturation     100969387 (INS)    04917 Prolactin signaling pathway     100969387 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     100969387 (INS)   09149 Aging    04211 Longevity regulating pathway     100969387 (INS)    04213 Longevity regulating pathway - multiple species     100969387 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     100969387 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     100969387 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     100969387 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100969387 (INS)    04940 Type I diabetes mellitus     100969387 (INS)    04950 Maturity onset diabetes of the young     100969387 (INS)    04932 Non-alcoholic fatty liver disease     100969387 (INS)    04931 Insulin resistance     100969387 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100969387 (INS) Cytokines and neuropeptides [BR:pps04052]  Neuropeptides   Unclassified    100969387 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  100969387 NCBI-ProteinID:  XP_034787832 Ensembl:  ENSPPAG00000040990 LinkDB All DBs Position 9:complement(4586153..4587845) Genome browser AA seq 204 aa AA seqDB search MGSETIKPAGTQQPSALQDRLHQKRPSSRSVPRAFASGGLRVPGWLDPRPQLCSREDVAG LLKHVGVSPGAPRQGTWPSAGLSPACLPDHCPSAMALWMRLLPLLALLALWGPDPASAFV NQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSL QKRGIVEQCCTSICSLYQLENYCN NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atgggctctgagactataaagccagcggggacccagcagccctcagccctccaggacagg ctgcatcagaagaggccatcaagcaggtctgttccaagggcctttgcgtcaggtgggctc agggttccagggtggctggaccccaggccccagctctgcagcagggaggatgtggctggg ctcttgaagcatgtgggggtgagcccaggggccccaaggcagggcacctggccttcagcc ggcctcagccctgcctgtctcccagatcactgtccttctgccatggccctgtggatgcgc ctcctgcccctgctggcgctgctggccctctggggacctgacccagcctcggcctttgtg aaccaacacctgtgcggctcccacctggtggaagctctctacctagtgtgcggggaacga ggcttcttctacacacccaagacccgccgggaggcagaggacctgcaggtggggcaggtg gagctgggcgggggccctggtgcaggcagcctgcagcccttggccctggaggggtccctg cagaagcgtggtatcgtggaacaatgctgtaccagcatctgctccctctaccagctggag aactactgcaactag

DBGET integrated database retrieval system