Pan paniscus (bonobo): 100969487
Help
Entry
100969487 CDS
T02283
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
pps
Pan paniscus (bonobo)
Pathway
pps03050
Proteasome
pps05010
Alzheimer disease
pps05012
Parkinson disease
pps05014
Amyotrophic lateral sclerosis
pps05016
Huntington disease
pps05017
Spinocerebellar ataxia
pps05020
Prion disease
pps05022
Pathways of neurodegeneration - multiple diseases
pps05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
pps00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
100969487 (PSMD7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
100969487 (PSMD7)
09164 Neurodegenerative disease
05010 Alzheimer disease
100969487 (PSMD7)
05012 Parkinson disease
100969487 (PSMD7)
05014 Amyotrophic lateral sclerosis
100969487 (PSMD7)
05016 Huntington disease
100969487 (PSMD7)
05017 Spinocerebellar ataxia
100969487 (PSMD7)
05020 Prion disease
100969487 (PSMD7)
05022 Pathways of neurodegeneration - multiple diseases
100969487 (PSMD7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
pps03051
]
100969487 (PSMD7)
Proteasome [BR:
pps03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
100969487 (PSMD7)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MitMem_reg
JAB
Connexin
Coilin_N
Motif
Other DBs
NCBI-GeneID:
100969487
NCBI-ProteinID:
XP_003829560
Ensembl:
ENSPPAG00000038728
UniProt:
A0A2R9BYL8
LinkDB
All DBs
Position
18:complement(79838951..79848483)
Genome browser
AA seq
324 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
KEDKEKDKDKEKSDVKKEEKKEKK
NT seq
975 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggcggtgcagaaggtggtggtccaccccctggtgctgctcagtgtggtg
gatcatttcaaccgaatcggcaaggttggaaaccagaagcgtgttgttggtgtgcttttg
gggtcatggcaaaagaaagtacttgatgtatcgaacagttttgcagttccttttgatgaa
gatgacaaagacgattctgtatggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaagtcaatgccagggaaagaatagttggctggtaccacacaggccctaaa
ctacacaagaatgacattgccatcaacgaactcatgaaaagatactgtcctaattccgta
ttggtcatcattgatgtgaagccgaaggacctagggctgcctacagaagcgtacatttca
gtggaagaagtccatgatgatggaactccaacctcgaaaacatttgaacacgtgaccagt
gaaataggagcagaggaagctgaggaagttggagttgaacacttgttacgagatatcaaa
gacacgacggtgggcactctgtcccagcggatcacaaaccaggtccatggtttgaaggga
ctgaactccaagcttctggatatcaggagctacctggaaaaagtcgccacaggcaagctg
cccatcaaccaccagatcatctaccagctgcaggacgtcttcaacctgctgccagacgtc
agcctgcaggagttcgtcaaggccttttacctgaagaccaatgaccagatggtggtagtg
tacttggcctcgctgatccgttccgtggtcgccctgcacaacctcatcaacaacaagatt
gccaaccgggatgcagagaagaaagaagggcaggagaaagaagagagcaaaaaggatagg
aaagaggacaaggagaaagataaagataaggaaaagagtgatgtaaagaaagaggagaaa
aaggagaaaaagtaa
DBGET
integrated database retrieval system