Pan paniscus (bonobo): 100969952 Help Entry 100969952         CDS       T02283                                  Symbol NXT1 Name (RefSeq) NTF2-related export protein 1   KO K14285   NTF2-related export protein 1/2 Organism pps  Pan paniscus (bonobo) Pathway pps03008   Ribosome biogenesis in eukaryotes pps03013   Nucleocytoplasmic transport pps03015   mRNA surveillance pathway pps05014   Amyotrophic lateral sclerosis pps05164   Influenza A Brite KEGG Orthology (KO) [BR:pps00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     100969952 (NXT1)    03015 mRNA surveillance pathway     100969952 (NXT1)    03008 Ribosome biogenesis in eukaryotes     100969952 (NXT1)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     100969952 (NXT1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100969952 (NXT1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pps03019]     100969952 (NXT1)    03009 Ribosome biogenesis [BR:pps03009]     100969952 (NXT1) Messenger RNA biogenesis [BR:pps03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      100969952 (NXT1) Ribosome biogenesis [BR:pps03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     100969952 (NXT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NTF2 NXF_NTF2 Cofilin_ADF Glyco_tran_10_N Motif Other DBs NCBI-GeneID:  100969952 NCBI-ProteinID:  XP_003829425 Ensembl:  ENSPPAG00000020479 UniProt:  A0A2R8ZJN6 LinkDB All DBs Position 21:24216690..24227958 Genome browser AA seq 140 aa AA seqDB search MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQAS PSNTVWKIASDCFRFQDWAS NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcatctgtggatttcaagacctatgtggatcaggcctgcagagctgctgaggagttt gtcaatgtctactacaccaccatggataagcggcggcgtttgctgtcccgcctgtacatg ggcacagccaccctggtctggaatggcaatgctgtttcaggacaagaatccttgagtgag ttttttgaaatgttgccttccagcgagttccaaatcagtgtggtagactgccagcctgtt catgatgaagccacaccgagtcagaccacggtccttgttgtgatctgtggatcagtgaag tttgaggggaacaaacaacgggacttcaaccagaacttcatcctgaccgcccaggcctca cccagcaacacagtgtggaagatcgcaagtgactgcttccgcttccaggactgggccagc tag

DBGET integrated database retrieval system