Pan paniscus (bonobo): 100970414 Help Entry 100970414         CDS       T02283                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism pps  Pan paniscus (bonobo) Pathway pps04613   Neutrophil extracellular trap formation pps05034   Alcoholism pps05202   Transcriptional misregulation in cancer pps05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pps00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100970414  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100970414   09163 Immune disease    05322 Systemic lupus erythematosus     100970414   09165 Substance dependence    05034 Alcoholism     100970414  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pps03036]     100970414   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pps04147]     100970414 Chromosome and associated proteins [BR:pps03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100970414 Exosome [BR:pps04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100970414 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  100970414 NCBI-ProteinID:  XP_003814967 Ensembl:  ENSPPAG00000003422 UniProt:  A0A2R8Z7U5 LinkDB All DBs Position 1:complement(23465745..23475101) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcacccaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcgctccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggactttaaa acagatctgcgcttccagagcgcagctatcggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system