Pan paniscus (bonobo): 100970465 Help Entry 100970465         CDS       T02283                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X2   KO K07828   GTPase NRas Organism pps  Pan paniscus (bonobo) Pathway pps01521   EGFR tyrosine kinase inhibitor resistance pps01522   Endocrine resistance pps04010   MAPK signaling pathway pps04012   ErbB signaling pathway pps04014   Ras signaling pathway pps04015   Rap1 signaling pathway pps04062   Chemokine signaling pathway pps04068   FoxO signaling pathway pps04071   Sphingolipid signaling pathway pps04072   Phospholipase D signaling pathway pps04137   Mitophagy - animal pps04140   Autophagy - animal pps04150   mTOR signaling pathway pps04151   PI3K-Akt signaling pathway pps04210   Apoptosis pps04211   Longevity regulating pathway pps04213   Longevity regulating pathway - multiple species pps04218   Cellular senescence pps04360   Axon guidance pps04370   VEGF signaling pathway pps04371   Apelin signaling pathway pps04540   Gap junction pps04550   Signaling pathways regulating pluripotency of stem cells pps04625   C-type lectin receptor signaling pathway pps04650   Natural killer cell mediated cytotoxicity pps04660   T cell receptor signaling pathway pps04662   B cell receptor signaling pathway pps04664   Fc epsilon RI signaling pathway pps04714   Thermogenesis pps04720   Long-term potentiation pps04722   Neurotrophin signaling pathway pps04725   Cholinergic synapse pps04726   Serotonergic synapse pps04730   Long-term depression pps04810   Regulation of actin cytoskeleton pps04910   Insulin signaling pathway pps04912   GnRH signaling pathway pps04915   Estrogen signaling pathway pps04916   Melanogenesis pps04917   Prolactin signaling pathway pps04919   Thyroid hormone signaling pathway pps04921   Oxytocin signaling pathway pps04926   Relaxin signaling pathway pps04929   GnRH secretion pps04933   AGE-RAGE signaling pathway in diabetic complications pps04935   Growth hormone synthesis, secretion and action pps05010   Alzheimer disease pps05022   Pathways of neurodegeneration - multiple diseases pps05034   Alcoholism pps05160   Hepatitis C pps05161   Hepatitis B pps05163   Human cytomegalovirus infection pps05165   Human papillomavirus infection pps05166   Human T-cell leukemia virus 1 infection pps05167   Kaposi sarcoma-associated herpesvirus infection pps05170   Human immunodeficiency virus 1 infection pps05200   Pathways in cancer pps05203   Viral carcinogenesis pps05205   Proteoglycans in cancer pps05206   MicroRNAs in cancer pps05207   Chemical carcinogenesis - receptor activation pps05208   Chemical carcinogenesis - reactive oxygen species pps05210   Colorectal cancer pps05211   Renal cell carcinoma pps05213   Endometrial cancer pps05214   Glioma pps05215   Prostate cancer pps05216   Thyroid cancer pps05218   Melanoma pps05219   Bladder cancer pps05220   Chronic myeloid leukemia pps05221   Acute myeloid leukemia pps05223   Non-small cell lung cancer pps05224   Breast cancer pps05225   Hepatocellular carcinoma pps05226   Gastric cancer pps05230   Central carbon metabolism in cancer pps05231   Choline metabolism in cancer pps05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pps05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100970465 (NRAS)    04012 ErbB signaling pathway     100970465 (NRAS)    04014 Ras signaling pathway     100970465 (NRAS)    04015 Rap1 signaling pathway     100970465 (NRAS)    04370 VEGF signaling pathway     100970465 (NRAS)    04371 Apelin signaling pathway     100970465 (NRAS)    04068 FoxO signaling pathway     100970465 (NRAS)    04072 Phospholipase D signaling pathway     100970465 (NRAS)    04071 Sphingolipid signaling pathway     100970465 (NRAS)    04151 PI3K-Akt signaling pathway     100970465 (NRAS)    04150 mTOR signaling pathway     100970465 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100970465 (NRAS)    04137 Mitophagy - animal     100970465 (NRAS)   09143 Cell growth and death    04210 Apoptosis     100970465 (NRAS)    04218 Cellular senescence     100970465 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     100970465 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     100970465 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100970465 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100970465 (NRAS)    04650 Natural killer cell mediated cytotoxicity     100970465 (NRAS)    04660 T cell receptor signaling pathway     100970465 (NRAS)    04662 B cell receptor signaling pathway     100970465 (NRAS)    04664 Fc epsilon RI signaling pathway     100970465 (NRAS)    04062 Chemokine signaling pathway     100970465 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     100970465 (NRAS)    04929 GnRH secretion     100970465 (NRAS)    04912 GnRH signaling pathway     100970465 (NRAS)    04915 Estrogen signaling pathway     100970465 (NRAS)    04917 Prolactin signaling pathway     100970465 (NRAS)    04921 Oxytocin signaling pathway     100970465 (NRAS)    04926 Relaxin signaling pathway     100970465 (NRAS)    04935 Growth hormone synthesis, secretion and action     100970465 (NRAS)    04919 Thyroid hormone signaling pathway     100970465 (NRAS)    04916 Melanogenesis     100970465 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     100970465 (NRAS)    04726 Serotonergic synapse     100970465 (NRAS)    04720 Long-term potentiation     100970465 (NRAS)    04730 Long-term depression     100970465 (NRAS)    04722 Neurotrophin signaling pathway     100970465 (NRAS)   09158 Development and regeneration    04360 Axon guidance     100970465 (NRAS)   09149 Aging    04211 Longevity regulating pathway     100970465 (NRAS)    04213 Longevity regulating pathway - multiple species     100970465 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     100970465 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100970465 (NRAS)    05206 MicroRNAs in cancer     100970465 (NRAS)    05205 Proteoglycans in cancer     100970465 (NRAS)    05207 Chemical carcinogenesis - receptor activation     100970465 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     100970465 (NRAS)    05203 Viral carcinogenesis     100970465 (NRAS)    05230 Central carbon metabolism in cancer     100970465 (NRAS)    05231 Choline metabolism in cancer     100970465 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100970465 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     100970465 (NRAS)    05225 Hepatocellular carcinoma     100970465 (NRAS)    05226 Gastric cancer     100970465 (NRAS)    05214 Glioma     100970465 (NRAS)    05216 Thyroid cancer     100970465 (NRAS)    05221 Acute myeloid leukemia     100970465 (NRAS)    05220 Chronic myeloid leukemia     100970465 (NRAS)    05218 Melanoma     100970465 (NRAS)    05211 Renal cell carcinoma     100970465 (NRAS)    05219 Bladder cancer     100970465 (NRAS)    05215 Prostate cancer     100970465 (NRAS)    05213 Endometrial cancer     100970465 (NRAS)    05224 Breast cancer     100970465 (NRAS)    05223 Non-small cell lung cancer     100970465 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100970465 (NRAS)    05170 Human immunodeficiency virus 1 infection     100970465 (NRAS)    05161 Hepatitis B     100970465 (NRAS)    05160 Hepatitis C     100970465 (NRAS)    05163 Human cytomegalovirus infection     100970465 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     100970465 (NRAS)    05165 Human papillomavirus infection     100970465 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     100970465 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     100970465 (NRAS)   09165 Substance dependence    05034 Alcoholism     100970465 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100970465 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100970465 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100970465 (NRAS)    01522 Endocrine resistance     100970465 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pps04131]     100970465 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pps04147]     100970465 (NRAS)    04031 GTP-binding proteins [BR:pps04031]     100970465 (NRAS) Membrane trafficking [BR:pps04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     100970465 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     100970465 (NRAS) Exosome [BR:pps04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100970465 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    100970465 (NRAS)   Exosomal proteins of breast cancer cells    100970465 (NRAS)   Exosomal proteins of colorectal cancer cells    100970465 (NRAS) GTP-binding proteins [BR:pps04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100970465 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  100970465 NCBI-ProteinID:  XP_008971793 Ensembl:  ENSPPAG00000037915 UniProt:  A0A2R9BN07 LinkDB All DBs Position 1:complement(107366720..107378995) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac agaaaacaagtggttatagatggtgaaacctgtttgttggacatactggatacagctgga caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt aagcgagtaaaagactcggatgatgtacctatggtgctagtgggaaacaagtgtgatttg ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt tgtatgggattgccatgtgtggtgatgtaa

DBGET integrated database retrieval system