Pan paniscus (bonobo): 100970658 Help Entry 100970658         CDS       T02283                                  Name (RefSeq) interferon alpha-14   KO K05414   interferon alpha Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04151   PI3K-Akt signaling pathway pps04217   Necroptosis pps04620   Toll-like receptor signaling pathway pps04621   NOD-like receptor signaling pathway pps04622   RIG-I-like receptor signaling pathway pps04623   Cytosolic DNA-sensing pathway pps04630   JAK-STAT signaling pathway pps04650   Natural killer cell mediated cytotoxicity pps04936   Alcoholic liver disease pps05152   Tuberculosis pps05160   Hepatitis C pps05161   Hepatitis B pps05162   Measles pps05163   Human cytomegalovirus infection pps05164   Influenza A pps05165   Human papillomavirus infection pps05167   Kaposi sarcoma-associated herpesvirus infection pps05168   Herpes simplex virus 1 infection pps05169   Epstein-Barr virus infection pps05170   Human immunodeficiency virus 1 infection pps05171   Coronavirus disease - COVID-19 pps05200   Pathways in cancer pps05320   Autoimmune thyroid disease pps05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100970658    04151 PI3K-Akt signaling pathway     100970658   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100970658  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100970658  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100970658    04621 NOD-like receptor signaling pathway     100970658    04622 RIG-I-like receptor signaling pathway     100970658    04623 Cytosolic DNA-sensing pathway     100970658    04650 Natural killer cell mediated cytotoxicity     100970658  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100970658   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100970658    05161 Hepatitis B     100970658    05160 Hepatitis C     100970658    05171 Coronavirus disease - COVID-19     100970658    05164 Influenza A     100970658    05162 Measles     100970658    05168 Herpes simplex virus 1 infection     100970658    05163 Human cytomegalovirus infection     100970658    05167 Kaposi sarcoma-associated herpesvirus infection     100970658    05169 Epstein-Barr virus infection     100970658    05165 Human papillomavirus infection     100970658   09171 Infectious disease: bacterial    05152 Tuberculosis     100970658   09163 Immune disease    05320 Autoimmune thyroid disease     100970658   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100970658   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100970658  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100970658 Cytokines and neuropeptides [BR:pps04052]  Cytokines   Interferons    100970658 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  100970658 NCBI-ProteinID:  XP_003830720 Ensembl:  ENSPPAG00000006950 UniProt:  A0A2R8ZDB6 LinkDB All DBs Position 11:103290574..103291576 Genome browser AA seq 189 aa AA seqDB search MALPFALMMALVVLSCKSSCSLGCDLSQTHSLNNRRTLMLMTQMRRISPFSCLKDRHDFE FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKNSSAAWDETLLDKFYIELFQQMNDLE ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTN LQKRLRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggcgttgccctttgctttaatgatggccctggtggtgctcagctgcaagtcaagctgc tctctgggctgtgatctgtctcaaacccacagcctgaataacaggaggactttgatgctt atgacacaaatgaggagaatctctcctttctcctgcctgaaggacagacatgactttgaa tttccccaggaggaatttgatggcaaccagtttcagaaagctcaagccatctctgtcctc catgagatgatccagcagaccttcaatctcttcagcacaaagaactcatctgctgcttgg gatgagaccctcctagacaaattctacattgaacttttccagcaaatgaatgacctggaa gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactctatc ctggctgtgaggaaatactttcaaagaatcactctttatctgatggagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac ttgcaaaaaagattaaggaggaaggattga

DBGET integrated database retrieval system