Pan paniscus (bonobo): 100971258 Help Entry 100971258         CDS       T02283                                  Name (RefSeq) metallothionein-1L-like   KO K14739   metallothionein 1/2 Organism pps  Pan paniscus (bonobo) Pathway pps04978   Mineral absorption Brite KEGG Orthology (KO) [BR:pps00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     100971258  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pps03019]     100971258    03029 Mitochondrial biogenesis [BR:pps03029]     100971258 Messenger RNA biogenesis [BR:pps03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100971258 Mitochondrial biogenesis [BR:pps03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     100971258 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  100971258 NCBI-ProteinID:  XP_008975686 Ensembl:  ENSPPAG00000032182 UniProt:  A0A2R9AL68 LinkDB All DBs Position 18:complement(66139643..66141022) Genome browser AA seq 61 aa AA seqDB search MDPNCSCAAGVSCACASSCKCKECKCTSCKKSCCSCCPMGCAKCAQGCICKGASEKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcgccgctggtgtctcctgcgcctgcgccagctcctgcaag tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccctatgggc tgtgccaaatgtgcccagggctgcatctgcaaaggggcatcggagaagtgcagctgctgc gcctga

DBGET integrated database retrieval system