Pan paniscus (bonobo): 100972867 Help Entry 100972867         CDS       T02283                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism pps  Pan paniscus (bonobo) Pathway pps04024   cAMP signaling pathway pps04062   Chemokine signaling pathway pps04064   NF-kappa B signaling pathway pps04210   Apoptosis pps04380   Osteoclast differentiation pps04620   Toll-like receptor signaling pathway pps04621   NOD-like receptor signaling pathway pps04622   RIG-I-like receptor signaling pathway pps04623   Cytosolic DNA-sensing pathway pps04625   C-type lectin receptor signaling pathway pps04657   IL-17 signaling pathway pps04658   Th1 and Th2 cell differentiation pps04659   Th17 cell differentiation pps04660   T cell receptor signaling pathway pps04662   B cell receptor signaling pathway pps04668   TNF signaling pathway pps04722   Neurotrophin signaling pathway pps04920   Adipocytokine signaling pathway pps04926   Relaxin signaling pathway pps04931   Insulin resistance pps04936   Alcoholic liver disease pps05132   Salmonella infection pps05134   Legionellosis pps05135   Yersinia infection pps05140   Leishmaniasis pps05142   Chagas disease pps05145   Toxoplasmosis pps05160   Hepatitis C pps05161   Hepatitis B pps05162   Measles pps05163   Human cytomegalovirus infection pps05164   Influenza A pps05166   Human T-cell leukemia virus 1 infection pps05167   Kaposi sarcoma-associated herpesvirus infection pps05168   Herpes simplex virus 1 infection pps05169   Epstein-Barr virus infection pps05170   Human immunodeficiency virus 1 infection pps05171   Coronavirus disease - COVID-19 pps05200   Pathways in cancer pps05203   Viral carcinogenesis pps05208   Chemical carcinogenesis - reactive oxygen species pps05215   Prostate cancer pps05220   Chronic myeloid leukemia pps05222   Small cell lung cancer pps05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pps05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100972867 (NFKBIA)    04668 TNF signaling pathway     100972867 (NFKBIA)    04024 cAMP signaling pathway     100972867 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100972867 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100972867 (NFKBIA)    04621 NOD-like receptor signaling pathway     100972867 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     100972867 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     100972867 (NFKBIA)    04625 C-type lectin receptor signaling pathway     100972867 (NFKBIA)    04660 T cell receptor signaling pathway     100972867 (NFKBIA)    04658 Th1 and Th2 cell differentiation     100972867 (NFKBIA)    04659 Th17 cell differentiation     100972867 (NFKBIA)    04657 IL-17 signaling pathway     100972867 (NFKBIA)    04662 B cell receptor signaling pathway     100972867 (NFKBIA)    04062 Chemokine signaling pathway     100972867 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     100972867 (NFKBIA)    04926 Relaxin signaling pathway     100972867 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     100972867 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     100972867 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100972867 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     100972867 (NFKBIA)    05203 Viral carcinogenesis     100972867 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100972867 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     100972867 (NFKBIA)    05215 Prostate cancer     100972867 (NFKBIA)    05222 Small cell lung cancer     100972867 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100972867 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     100972867 (NFKBIA)    05161 Hepatitis B     100972867 (NFKBIA)    05160 Hepatitis C     100972867 (NFKBIA)    05171 Coronavirus disease - COVID-19     100972867 (NFKBIA)    05164 Influenza A     100972867 (NFKBIA)    05162 Measles     100972867 (NFKBIA)    05168 Herpes simplex virus 1 infection     100972867 (NFKBIA)    05163 Human cytomegalovirus infection     100972867 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     100972867 (NFKBIA)    05169 Epstein-Barr virus infection     100972867 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     100972867 (NFKBIA)    05135 Yersinia infection     100972867 (NFKBIA)    05134 Legionellosis     100972867 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100972867 (NFKBIA)    05140 Leishmaniasis     100972867 (NFKBIA)    05142 Chagas disease     100972867 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100972867 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100972867 (NFKBIA)    04931 Insulin resistance     100972867 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pps03000]     100972867 (NFKBIA)    04131 Membrane trafficking [BR:pps04131]     100972867 (NFKBIA) Transcription factors [BR:pps03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     100972867 (NFKBIA) Membrane trafficking [BR:pps04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100972867 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  100972867 NCBI-ProteinID:  XP_024781242 Ensembl:  ENSPPAG00000041784 LinkDB All DBs Position 15:complement(36715927..36722262) Genome browser AA seq 317 aa AA seqDB search MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE DELPYDDCVFGGQRLTL NT seq 954 nt NT seq  +upstreamnt  +downstreamnt atgttccaggcggccgagcgcccccaggagtgggccatggagggcccccgcgacgggctg aagaaggagcggctactggacgaccgccacgacagcggcctggactccatgaaagacgag gagtacgagcagatggtcaaggagctgcaggagatccgcctcgagccgcaggaggtgccg cgcggcgcggagccctggaagcagcagctcaccgaggacggggactcgttcctgcacttg gccatcatccatgaagaaaaggcactgaccatggaagtgatccgccaggtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccagccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagcgtg ggagtcctgactcagtcctgcaccaccccgcacctccactccatcctgaaggctaccaac tacaatggccacacgtgtctacacttagcctctatccatggctacctgggcatcgtggag cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggccggactgcc cttcacctcgcagtggacctgcagaatcctgacctggtgtcactcctgttgaagtgtggg gctgatgtcaacagagttacctaccagggctattctccctaccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgacactagaaaaccttcagatgctg ccagagagtgaggatgaggagagctatgacacagagtcagagttcacggagttcacagag gacgagctgccctatgatgactgtgtgtttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system