Pan paniscus (bonobo): 100974217 Help Entry 100974217         CDS       T02283                                  Symbol GHRH Name (RefSeq) somatoliberin isoform X2   KO K05260   growth hormone-releasing hormone Organism pps  Pan paniscus (bonobo) Pathway pps04080   Neuroactive ligand-receptor interaction pps04081   Hormone signaling pps04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100974217 (GHRH)    04081 Hormone signaling     100974217 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     100974217 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100974217 (GHRH) Cytokines and neuropeptides [BR:pps04052]  Neuropeptides   GPCR binding    100974217 (GHRH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  100974217 NCBI-ProteinID:  XP_008955536 Ensembl:  ENSPPAG00000035360 UniProt:  A0A2R9B5V6 LinkDB All DBs Position 21:complement(42978526..42985770) Genome browser AA seq 108 aa AA seqDB search MPLWVFFFVILTLSSSSHCSPSPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSR QQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgccactctgggtgttcttctttgtgatcctcaccctcagcagcagctcccactgctcc ccatctccccctttgaccctcaggatgcggcggtatgcagatgccatcttcaccaacagc taccggaaggtgctgggccagctgtccgcccgcaagctgctccaggacatcatgagcagg cagcagggagagagcaaccaagagcgaggagcaagggcacggcttggtcgtcaggtagac agcatgtgggcagaacaaaagcaaatggaattggagagcatcctggtggccctgctgcag aagcacagcaggaactcccagggatga

DBGET integrated database retrieval system