Pan paniscus (bonobo): 100976236 Help Entry 100976236         CDS       T02283                                  Symbol PPBP Name (RefSeq) platelet basic protein   KO K10029   platelet basic protein Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04061   Viral protein interaction with cytokine and cytokine receptor pps04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100976236 (PPBP)    04061 Viral protein interaction with cytokine and cytokine receptor     100976236 (PPBP)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     100976236 (PPBP)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100976236 (PPBP) Cytokines and neuropeptides [BR:pps04052]  Cytokines   Chemokines    100976236 (PPBP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100976236 NCBI-ProteinID:  XP_003832378 Ensembl:  ENSPPAG00000042155 UniProt:  A0A2R9CA87 LinkDB All DBs Position 3:56071080..56073080 Genome browser AA seq 128 aa AA seqDB search MSLRVDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAE LRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKK LAGDESAD NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagcctcagagttgataccaccccttcctgtaacagtgcgagaccacttcatgccttg caggtgctgctgcttctgtcgttgctgctgactgctctggcttcctccaccaaaggacaa actaagagaaacttggcaaaaggcaaagaggaaagtttagacagtgacttgtatgctgaa ctccgctgcatgtgtataaagacaacctctggaattcatcccaaaaacatccaaagtttg gaagtgatcgggaaaggaacccattgcaaccaagtcgaagtgatagccacactgaaggat gggaggaaaatctgcctggacccagatgctcccagaatcaagaaaattgtacagaaaaaa ttggcaggtgatgaatctgctgattaa

DBGET integrated database retrieval system