Pan paniscus (bonobo): 100976239 Help Entry 100976239         CDS       T02283                                  Symbol NPS Name (RefSeq) neuropeptide S   KO K25691   neuropeptide S Organism pps  Pan paniscus (bonobo) Pathway pps04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100976239 (NPS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100976239 (NPS) Cytokines and neuropeptides [BR:pps04052]  Neuropeptides   GPCR binding    100976239 (NPS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Neuropeptide_S Zona_pellucida Motif Other DBs NCBI-GeneID:  100976239 NCBI-ProteinID:  XP_057154776 Ensembl:  ENSPPAG00000028558 LinkDB All DBs Position 8:139426346..139429899 Genome browser AA seq 89 aa AA seqDB search MISSLKLNLILVLSLSTMHVFWCFPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKP ILEKMFVKRSFRNGVGTGMKKTSFRRAKS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgattagctcattaaaactcaatctcatcctagttctgtcgctgtccacaatgcatgtg ttttggtgttttccagttccgtcttctaaggtgtctggaaaatctgattactttctcatt ctgctgaacagctgcccaaccagattggacaggagcaaagaactagcttttctaaagcca attttggagaagatgtttgtgaaaaggtcctttcgcaatggagttggcacagggatgaaa aaaacttcctttcgaagagcaaaatcatga

DBGET integrated database retrieval system