KEGG   Pan paniscus (bonobo): 100976333
Entry
100976333         CDS       T02283                                 
Symbol
CYP3A5
Name
(RefSeq) cytochrome P450 3A5 isoform X1
  KO
K17690  cytochrome P450 family 3 subfamily A5 [EC:1.14.14.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00140  Steroid hormone biosynthesis
pps00830  Retinol metabolism
pps00980  Metabolism of xenobiotics by cytochrome P450
pps00982  Drug metabolism - cytochrome P450
pps01100  Metabolic pathways
pps05204  Chemical carcinogenesis - DNA adducts
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100976333 (CYP3A5)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100976333 (CYP3A5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100976333 (CYP3A5)
   00982 Drug metabolism - cytochrome P450
    100976333 (CYP3A5)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    100976333 (CYP3A5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pps00199]
    100976333 (CYP3A5)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100976333 (CYP3A5)
Cytochrome P450 [BR:pps00199]
 Cytochrome P450, animal type
  CYP3 family
   100976333 (CYP3A5)
SSDB
Motif
Pfam: p450 Coa1
Other DBs
NCBI-GeneID: 100976333
NCBI-ProteinID: XP_003815757
Ensembl: ENSPPAG00000038928
VGNC: 83023
UniProt: A0A2R9BZX8
LinkDB
Position
7:complement(91621561..91654164)
AA seq 502 aa
MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKF
DTECYKKYGKMWGMYDGQLPVLAITDPDMIRTVLVKECYSVFTNRRSLGPVGFMKSAISL
AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYS
MDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSL
FPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSI
IFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVV
NETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFS
KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQG
LLQPEKPIVLKVDSRDGTLSGE
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggacctcatcccaaatttggcggtggaaacctggcttctcctggctgtcagcctggtg
ctcctctatctatatgggacccgtacacatggactttttaagagactgggaattccaggg
cccacacctctgcctttgttgggaaatgttttgtcctatcgtcagggtctctggaaattt
gacacagagtgctataaaaagtatgggaaaatgtggggaatgtatgatggtcaactccct
gtgctggccatcacagatcccgacatgatcagaacagtgctagtgaaagaatgttattct
gtcttcacaaatcgaaggtctttaggcccagtgggatttatgaaaagtgccatctcttta
gctgaggatgaagaatggaagagaatacggtcattgctgtctccaaccttcaccagcgga
aaactcaaggagatgttccccatcattgcccagtatggagatgtattggtgagaaacttg
aggcgggaagcagagaaaggcaagcctgtcaccttgaaagacatctttggggcctacagc
atggatgtgattactggcacatcatttggagtgaacatcgactctctcaacaatccacaa
gacccctttgtggagagcactaagaagttcctaaaatttggtttcttagatccattattt
ctctcaataatactctttccattccttaccccagtttttgaagcattaaatgtctctctg
tttccaaaagataccataaattttttaagtaaatctgtaaacagaatgaagaaaagtcgc
ctcaacgacaaacaaaagcaccgactagatttccttcagctgatgattgactcccagaat
tcgaaagaaactgagtcccacaaagctctgtctgatctggagctcgcagcccagtcaata
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcactttatatgaa
ctggccactcaccctgatgtccagcagaaactgcaaaaggagattgatgcagttttgccc
aataaggcaccacctacctatgatgccgtggtacagatggagtaccttgacatggtggtg
aatgaaacactcagattattcccagttgctattagacttgagaggacctgcaagaaagat
gttgaaatcaatggggtattcattcccaaagggtcaatggtggtgattccaacttatgct
cttcaccatgacccaaagtactggacagagcctgaggagttccgccctgaaaggttcagt
aagaagaaggacagcatagatccttacatatacacaccttttggaactggacccagaaac
tgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtccttcag
aacttctccttcaaaccttgtaaagaaacacagatccccttgaaattagacacgcaagga
cttcttcaaccagaaaaacccattgttctaaaggtggattcaagagatggaaccctaagt
ggagaatga

DBGET integrated database retrieval system