Pan paniscus (bonobo): 100976580 Help Entry 100976580         CDS       T02283                                  Symbol PF4 Name (RefSeq) platelet factor 4   KO K05407   platelet factor 4 Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04061   Viral protein interaction with cytokine and cytokine receptor pps04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100976580 (PF4)    04061 Viral protein interaction with cytokine and cytokine receptor     100976580 (PF4)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     100976580 (PF4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100976580 (PF4)    00536 Glycosaminoglycan binding proteins [BR:pps00536]     100976580 (PF4) Cytokines and neuropeptides [BR:pps04052]  Cytokines   Chemokines    100976580 (PF4) Glycosaminoglycan binding proteins [BR:pps00536]  Heparan sulfate / Heparin   Chemokines    100976580 (PF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100976580 NCBI-ProteinID:  XP_003832379 Ensembl:  ENSPPAG00000035945 UniProt:  A0A2R9BF33 LinkDB All DBs Position 3:56076726..56078720 Genome browser AA seq 101 aa AA seqDB search MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV IKAGPHCPTAQLIATLKNGRKICLNLQAPLYKKIIKKLLES NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgagctccgcagccgggttctgcgcctcacgccccgggctgctgttcctggggttgctg ctcctgccacttgtggtcgccttcgccagcgctgaagctgaagaagatggggacctgcag tgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagcctggaggtg atcaaggccggaccccactgccccactgcccaactgatagccacgctgaagaatgggagg aaaatttgcttgaacctgcaagccccgctgtacaagaaaataattaagaaacttttggag agttag

DBGET integrated database retrieval system