Pan paniscus (bonobo): 100978242 Help Entry 100978242         CDS       T02283                                  Symbol CCL19 Name (RefSeq) C-C motif chemokine 19   KO K05512   C-C motif chemokine 19 Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04061   Viral protein interaction with cytokine and cytokine receptor pps04062   Chemokine signaling pathway pps04064   NF-kappa B signaling pathway Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100978242 (CCL19)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100978242 (CCL19)    04061 Viral protein interaction with cytokine and cytokine receptor     100978242 (CCL19)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     100978242 (CCL19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100978242 (CCL19) Cytokines and neuropeptides [BR:pps04052]  Cytokines   Chemokines    100978242 (CCL19) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100978242 NCBI-ProteinID:  XP_003829861 Ensembl:  ENSPPAG00000033242 UniProt:  A0A2R9ARU8 LinkDB All DBs Position 11:89912711..89915161 Genome browser AA seq 98 aa AA seqDB search MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAV VFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSN NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggccctgctactggccctcagcctgctggttctctggacttccccagccccaactctg agtggcaccaatgatgctgaagactgctgcctgtctgtgacccagaaacccatcccgggg tacatcgtgaggaacttccactaccttctcatcaaggatggctgcagggtgcctgctgta gtgttcaccacactaaggggccgccagctctgtgcacccccagaccagccctgggtagaa cgcatcatccagagactgcagaggacctcagccaagatgaagcgccgcagcaattaa

DBGET integrated database retrieval system