Pan paniscus (bonobo): 100978369 Help Entry 100978369         CDS       T02283                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04061   Viral protein interaction with cytokine and cytokine receptor pps04062   Chemokine signaling pathway pps04064   NF-kappa B signaling pathway pps04072   Phospholipase D signaling pathway pps04218   Cellular senescence pps04620   Toll-like receptor signaling pathway pps04621   NOD-like receptor signaling pathway pps04622   RIG-I-like receptor signaling pathway pps04657   IL-17 signaling pathway pps04932   Non-alcoholic fatty liver disease pps04933   AGE-RAGE signaling pathway in diabetic complications pps04936   Alcoholic liver disease pps05132   Salmonella infection pps05133   Pertussis pps05134   Legionellosis pps05135   Yersinia infection pps05142   Chagas disease pps05144   Malaria pps05146   Amoebiasis pps05161   Hepatitis B pps05163   Human cytomegalovirus infection pps05164   Influenza A pps05167   Kaposi sarcoma-associated herpesvirus infection pps05171   Coronavirus disease - COVID-19 pps05200   Pathways in cancer pps05202   Transcriptional misregulation in cancer pps05219   Bladder cancer pps05323   Rheumatoid arthritis pps05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100978369 (CXCL8)    04072 Phospholipase D signaling pathway     100978369 (CXCL8)   09133 Signaling molecules and interaction    04061 Viral protein interaction with cytokine and cytokine receptor     100978369 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100978369 (CXCL8)    04657 IL-17 signaling pathway     100978369 (CXCL8)    04062 Chemokine signaling pathway     100978369 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100978369 (CXCL8)    05202 Transcriptional misregulation in cancer     100978369 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     100978369 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     100978369 (CXCL8)    05171 Coronavirus disease - COVID-19     100978369 (CXCL8)    05164 Influenza A     100978369 (CXCL8)    05163 Human cytomegalovirus infection     100978369 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     100978369 (CXCL8)   09171 Infectious disease: bacterial    05135 Yersinia infection     100978369 (CXCL8)    05133 Pertussis     100978369 (CXCL8)    05134 Legionellosis     100978369 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     100978369 (CXCL8)    05144 Malaria     100978369 (CXCL8)    05142 Chagas disease     100978369 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     100978369 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100978369 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100978369 (CXCL8)    04932 Non-alcoholic fatty liver disease     100978369 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     100978369 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100978369 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:pps00536]     100978369 (CXCL8) Cytokines and neuropeptides [BR:pps04052]  Cytokines   Chemokines    100978369 (CXCL8) Glycosaminoglycan binding proteins [BR:pps00536]  Heparan sulfate / Heparin   Chemokines    100978369 (CXCL8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  100978369 NCBI-ProteinID:  XP_003832383 Ensembl:  ENSPPAG00000029838 LinkDB All DBs Position 3:complement(56320800..56323963) Genome browser AA seq 99 aa AA seqDB search MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggccgtggctctcttggcagccttcctgatttctgcagctctgtgt gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagacatac tccaaacctttccaccccaaatttatcaaagaactgagagtgattgagagtggaccacac tgcgccaatacagaaattattgtaaagctttctgatggaagagagctctgtctggacccc aaggaaaactgggtgcagagggttgtggagaagtttttgaagagggctgagaattcataa

DBGET integrated database retrieval system