Pan paniscus (bonobo): 100979289 Help Entry 100979289         CDS       T02283                                  Name (RefSeq) histone H2B type 1-A   KO K11252   histone H2B Organism pps  Pan paniscus (bonobo) Pathway pps04613   Neutrophil extracellular trap formation pps05034   Alcoholism pps05203   Viral carcinogenesis pps05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pps00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100979289  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100979289   09163 Immune disease    05322 Systemic lupus erythematosus     100979289   09165 Substance dependence    05034 Alcoholism     100979289  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pps03036]     100979289   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pps04147]     100979289 Chromosome and associated proteins [BR:pps03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100979289 Exosome [BR:pps04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100979289 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like ARM_TT21 Motif Other DBs NCBI-GeneID:  100979289 NCBI-ProteinID:  XP_003823261 Ensembl:  ENSPPAG00000017937 UniProt:  A0A2R8ZGW2 LinkDB All DBs Position 5:40373762..40376421 Genome browser AA seq 127 aa AA seqDB search MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKA MSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccggaagtgtcgtctaaaggtgctaccatttccaagaagggctttaaaaaagctgtc gttaagacccagaagaaggagggcaaaaagcgcaagaggacccgtaaggagagttattct atttacatctacaaggtgctaaagcaggtccatccggacactgggatctcttcgaaagcc atgagcattatgaattccttcgtcactgatatctttgagcgtatagcgagcgaggcatca cgtttggctcactacagcaagcgctccaccatctcttccagagagattcagacagcagtg cgcttgctactgccgggagagctggctaaacatgctgtgtctgagggcaccaaggctgtc actaagtacaccagctccaaataa

DBGET integrated database retrieval system