Pan paniscus (bonobo): 100979524 Help Entry 100979524         CDS       T02283                                  Symbol MYL11 Name (RefSeq) myosin regulatory light chain 11   KO K12758   fast skeletal myosin light chain 2 Organism pps  Pan paniscus (bonobo) Pathway pps04510   Focal adhesion pps04520   Adherens junction pps04670   Leukocyte transendothelial migration pps04810   Regulation of actin cytoskeleton pps04814   Motor proteins pps04820   Cytoskeleton in muscle cells pps05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pps00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     100979524 (MYL11)    04520 Adherens junction     100979524 (MYL11)   09142 Cell motility    04814 Motor proteins     100979524 (MYL11)    04820 Cytoskeleton in muscle cells     100979524 (MYL11)    04810 Regulation of actin cytoskeleton     100979524 (MYL11)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     100979524 (MYL11)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100979524 (MYL11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pps04812]     100979524 (MYL11)    04147 Exosome [BR:pps04147]     100979524 (MYL11) Cytoskeleton proteins [BR:pps04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      100979524 (MYL11) Exosome [BR:pps04147]  Exosomal proteins   Exosomal proteins of hepatic cells    100979524 (MYL11) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 CFAP251_C EF_EFCAB10_C SAPC2_N AIF-1 Motif Other DBs NCBI-GeneID:  100979524 NCBI-ProteinID:  XP_057155999 Ensembl:  ENSPPAG00000022144 UniProt:  A0A2R8ZK43 LinkDB All DBs Position 18:33576287..33583184 Genome browser AA seq 169 aa AA seqDB search MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFL EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atggcacccaagagggccaagagaaggacagtagagggcggaagctccagcgtcttctcc atgttcgaccagactcagatccaggagttcaaagaggccttcactgtgatcgaccagaac cgtgatggtattatagacaaggaggaccttcgggacaccttcgcagccatgggccgcctc aatgtgaagaatgaggagttggatgccatgatgaaggaagccagcggtcccatcaacttc accgtcttcctgaccatgttcggggagaagctcaagggtgccgaccctgaggatgtgatc accggagccttcaaggtcctggaccctgagggaaagggcaccatcaagaagaagttcctg gaggagctgctgaccacgcagtgtgaccgcttctcccaggaggagatcaagaacatgtgg gcggccttcccccccgacgtgggcggcaacgtcgactacaaaaacatctgctatgtcatc acgcacggcgacgccaaggaccaggagtag

DBGET integrated database retrieval system