Pan paniscus (bonobo): 100979816 Help Entry 100979816         CDS       T02283                                  Symbol LTA Name (RefSeq) lymphotoxin-alpha   KO K05468   lymphotoxin alpha (TNF superfamily, member 1) Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04061   Viral protein interaction with cytokine and cytokine receptor pps04064   NF-kappa B signaling pathway pps04668   TNF signaling pathway pps04940   Type I diabetes mellitus pps05166   Human T-cell leukemia virus 1 infection pps05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100979816 (LTA)    04668 TNF signaling pathway     100979816 (LTA)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100979816 (LTA)    04061 Viral protein interaction with cytokine and cytokine receptor     100979816 (LTA)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100979816 (LTA)    05168 Herpes simplex virus 1 infection     100979816 (LTA)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100979816 (LTA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100979816 (LTA) Cytokines and neuropeptides [BR:pps04052]  Cytokines   Tumor necrosis fators    100979816 (LTA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  100979816 NCBI-ProteinID:  XP_003831645 Ensembl:  ENSPPAG00000039140 UniProt:  A0A2R9BST5 LinkDB All DBs Position 5:46049233..46051266 Genome browser AA seq 205 aa AA seqDB search MTPPERLFLPRVRGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHST LKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAY SPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ LSTHTDGIPHLVLSPSTVFFGAFAL NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgacaccacctgaacgtctcttcctcccaagggtgcgtggcaccaccctacacctcctc cttctggggctgctgctggttctgctgcctggggcccaggggctccctggtgttggcctc acaccttcagctgcccagactgcccgtcagcaccccaagatgcatcttgcccacagcacc ctcaaacctgctgctcacctcattggagaccccagcaagcagaactcactgctctggaga gcaaacacggaccgtgccttcctccaggatggtttctccttgagcaacaattctctcctg gtccccaccagtggcatctacttcgtctactcccaggtggtcttctctgggaaagcctac tctcccaaggccacctcctccccactctacctggcccatgaggtccagctcttctcctcc cagtaccccttccacgtgcctctcctcagctcccagaagatggtgtatccagggctgcag gaaccctggctgcactcgatgtaccatggggctgcgttccagctcacccagggagaccag ctatccacccacacagatggcatcccccacctagtcctcagccctagtactgtcttcttt ggagccttcgctctgtag

DBGET integrated database retrieval system