Pan paniscus (bonobo): 100980572 Help Entry 100980572         CDS       T02283                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism pps  Pan paniscus (bonobo) Brite KEGG Orthology (KO) [BR:pps00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pps01002]     100980572 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pps04147]     100980572 (CSTB) Peptidases and inhibitors [BR:pps01002]  Peptidase inhibitors   Family I25: cystatin family    100980572 (CSTB) Exosome [BR:pps04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100980572 (CSTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light SQAPI Motif Other DBs NCBI-GeneID:  100980572 NCBI-ProteinID:  XP_034803849 UniProt:  P60575 LinkDB All DBs Position 22:complement(39780301..39783181) Genome browser AA seq 98 aa AA seqDB search MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVG DEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggggcgccctccgccacgcagccggccaccgccgagacccagcacatcgcc gaccaggtgaggtcccagcttgaagagaaagaaaacaagaagttccctgtgtttaaggcc gtgtcgttcaagagccaggtggtcgcggggacaaactacttcatcaaggtgcacgtcggc gacgaggacttcgtacacctgcgagtgttccaatctctccctcatgaaaacaagcccttg accttatctaactaccagaccaacaaagccaagcatgatgagctgacctatttctga

DBGET integrated database retrieval system