Pan paniscus (bonobo): 100981094 Help Entry 100981094         CDS       T02283                                  Name (RefSeq) adenylate kinase isoenzyme 1   KO K00939   adenylate kinase [EC:2.7.4.3] Organism pps  Pan paniscus (bonobo) Pathway pps00230   Purine metabolism pps00730   Thiamine metabolism pps01100   Metabolic pathways pps01232   Nucleotide metabolism pps01240   Biosynthesis of cofactors Module pps_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP Brite KEGG Orthology (KO) [BR:pps00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     100981094   09108 Metabolism of cofactors and vitamins    00730 Thiamine metabolism     100981094  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pps04147]     100981094 Enzymes [BR:pps01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.3  adenylate kinase      100981094 Exosome [BR:pps04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100981094 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  100981094 NCBI-ProteinID:  XP_054960038 LinkDB All DBs Position 20:10810574..10813498 Genome browser AA seq 111 aa AA seqDB search METMLRRVLHWGQVEHRAHDSELAIHQRLDTHYTLCELVLTFYQRNNLLQNIPAEEAPEN IFAKCCSVIEESAVRHRGWGWALPLTGTHAVRGKGAYLGGETSRKGDRCPL NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggagacgatgctccgacgagtgctacactggggccaggtggagcaccgggcacacgac tcggagctggccatccaccagcgcttggacacgcactataccttgtgtgagctggtcttg accttctaccagcgcaataacctgctccaaaacatcccggcagaggaagcaccagagaac atctttgccaaatgctgctctgtcattgaagagtctgcagtgagacacaggggctggggg tgggccttgcccctcaccggaacccatgcagtacgtgggaagggtgcgtatctaggaggt gagacctccagaaagggggaccgatgccccctgtga

DBGET integrated database retrieval system