Pan paniscus (bonobo): 100981304 Help Entry 100981304         CDS       T02283                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism pps  Pan paniscus (bonobo) Pathway pps04382   Cornified envelope formation pps05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pps00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     100981304 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100981304 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pps04147]     100981304 (S100A10) Exosome [BR:pps04147]  Exosomal proteins   Exosomal proteins of microglial cells    100981304 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  100981304 NCBI-ProteinID:  XP_034791552 Ensembl:  ENSPPAG00000037637 UniProt:  A0A2R9BHV8 LinkDB All DBs Position 1:97829200..97840350 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacacgccatggaaaccatgatgtttacatttcacaaattcgct ggggataaaggctacttaacaaaggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggctgtggacaaaataatgaaggacctggac cagtgcagagatggcaaagtgggcttccagagcttcttttccctaattgcgggcctcacc attgcatgcaatgactattttgtagtacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system