Pan paniscus (bonobo): 100981970 Help Entry 100981970         CDS       T02283                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism pps  Pan paniscus (bonobo) Pathway pps04814   Motor proteins pps05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pps00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     100981970 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100981970 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pps03037]     100981970 (DYNLT3)    04812 Cytoskeleton proteins [BR:pps04812]     100981970 (DYNLT3) Cilium and associated proteins [BR:pps03037]  Motile cilia and associated proteins   Dynein arm    100981970 (DYNLT3) Cytoskeleton proteins [BR:pps04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      100981970 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  100981970 NCBI-ProteinID:  XP_003815439 Ensembl:  ENSPPAG00000016400 UniProt:  A0A2R8ZFW4 LinkDB All DBs Position X:complement(39487750..39496644) Genome browser AA seq 116 aa AA seqDB search MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGK AYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccatcgccactgcgacgaggttggcttcaatgctgaggaagcccacaat attgtcaaagagtgtgtagatggggttttaggtggtgaagattataatcacaacaacatc aaccagtggactgcaagcatagtggaacaatccttaacacatctggttaagttgggaaaa gcttataaatatattgtgacctgtgcagtggtccagaagagcgcatatggctttcacaca gccagctcctgtttttgggataccacatctgatggaacctgtaccgtaagatgggagaac cggaccatgaactgtattgtcaacgtttttgccattgctattgttctttaa

DBGET integrated database retrieval system