Pan paniscus (bonobo): 100983944 Help Entry 100983944         CDS       T02283                                  Symbol MYL5 Name (RefSeq) myosin light chain 5 isoform X1   KO K12753   myosin regulatory light chain 5 Organism pps  Pan paniscus (bonobo) Pathway pps04360   Axon guidance pps04510   Focal adhesion pps04520   Adherens junction pps04670   Leukocyte transendothelial migration pps04810   Regulation of actin cytoskeleton pps04814   Motor proteins pps04820   Cytoskeleton in muscle cells pps05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pps00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     100983944 (MYL5)    04520 Adherens junction     100983944 (MYL5)   09142 Cell motility    04814 Motor proteins     100983944 (MYL5)    04820 Cytoskeleton in muscle cells     100983944 (MYL5)    04810 Regulation of actin cytoskeleton     100983944 (MYL5)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     100983944 (MYL5)   09158 Development and regeneration    04360 Axon guidance     100983944 (MYL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100983944 (MYL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pps04812]     100983944 (MYL5) Cytoskeleton proteins [BR:pps04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      100983944 (MYL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 EF_EFCAB10_C Lipoprotein_6 Caleosin AIF-1 Motif Other DBs NCBI-GeneID:  100983944 NCBI-ProteinID:  XP_054967071 Ensembl:  ENSPPAG00000039203 LinkDB All DBs Position 3:984318..990864 Genome browser AA seq 173 aa AA seqDB search MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI NKEYIKRLLMSQADKMTAEEVDQMFQFASIDAAGNLDYKALSYVITHGEEEEE NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atggccagcaggaagaccaagaagaaggaagggggtgccctccgggcccagagagcttca tccaatgtcttctccaactttgagcagactcagatccaggagttcaaggaggcattcaca ctcatggatcagaaccgagatggcttcattgacaaggaggacctgaaggacacctatgcc tccctgggcaagaccaacgtcaaggacgacgagctggacgccatgctcaaagaggcctcg gggcccatcaacttcaccatgtttctgaacctgtttggggagaagctgagcggtaccgac gccgaggaaaccattcttaacgccttcaagatgctggacccggacgggaaagggaaaatc aacaaggagtacatcaagcgtctgctgatgtcccaggctgacaagatgacggcggaagag gtggaccagatgttccagttcgcctccatcgatgcggcgggcaacctggactacaaggcg ctcagctacgtgatcacccacggggaggaggaggaggaatga

DBGET integrated database retrieval system