Pan paniscus (bonobo): 100984512 Help Entry 100984512         CDS       T02283                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism pps  Pan paniscus (bonobo) Pathway pps04621   NOD-like receptor signaling pathway pps05012   Parkinson disease pps05132   Salmonella infection pps05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100984512 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100984512 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     100984512 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100984512 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pps03110]     100984512 (TXN) Chaperones and folding catalysts [BR:pps03110]  Protein folding catalysts   Protein disulfide isomerase    100984512 (TXN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 Thioredoxin_9 AhpC-TSA Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  100984512 NCBI-ProteinID:  XP_003810932 Ensembl:  ENSPPAG00000042345 UniProt:  A0A2R9CE55 LinkDB All DBs Position 11:29150207..29162897 Genome browser AA seq 105 aa AA seqDB search MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagactgcttttcaggaagccttggacgctgcaggtgat aaacttgtagtagttgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcattccctctctgaaaagtattccaacgtgatattccttgaagtagatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaacattccagtttttt aagaagggacaaaaggtgggtgaattttctggagccaataaggaaaagcttgaagccacc attaatgaattagtctaa

DBGET integrated database retrieval system