Pan paniscus (bonobo): 100987642 Help Entry 100987642         CDS       T02283                                  Name (RefSeq) histone H2B type 1-O   KO K11252   histone H2B Organism pps  Pan paniscus (bonobo) Pathway pps04613   Neutrophil extracellular trap formation pps05034   Alcoholism pps05203   Viral carcinogenesis pps05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pps00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100987642  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100987642   09163 Immune disease    05322 Systemic lupus erythematosus     100987642   09165 Substance dependence    05034 Alcoholism     100987642  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pps03036]     100987642   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pps04147]     100987642 Chromosome and associated proteins [BR:pps03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100987642 Exosome [BR:pps04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100987642 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  100987642 NCBI-ProteinID:  XP_054969243 Ensembl:  ENSPPAG00000021679 LinkDB All DBs Position 5:42536365..42536745 Genome browser AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcccgacccggctaaatctgctcctgcccccaaaaagggctccaagaaagccgtaacc aaggcccagaaaaaggacggcaagaagcgcaagcgcagccgcaaagagagttactctatc tacgtgtacaaggtactgaagcaagtccaccccgacaccggcatctcatcgaaggccatg ggcatcatgaactccttcgtcaatgacatctttgagcgcatcgctggcgaggcttcccgc ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcacaaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system