Pan paniscus (bonobo): 100989221 Help Entry 100989221         CDS       T02283                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism pps  Pan paniscus (bonobo) Pathway pps04010   MAPK signaling pathway pps04014   Ras signaling pathway pps04015   Rap1 signaling pathway pps04024   cAMP signaling pathway pps04072   Phospholipase D signaling pathway pps04137   Mitophagy - animal pps04140   Autophagy - animal pps04218   Cellular senescence pps04360   Axon guidance pps04371   Apelin signaling pathway pps04519   Cadherin signaling pps04625   C-type lectin receptor signaling pathway pps04810   Regulation of actin cytoskeleton pps05132   Salmonella infection pps05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100989221 (RRAS)    04014 Ras signaling pathway     100989221 (RRAS)    04015 Rap1 signaling pathway     100989221 (RRAS)    04371 Apelin signaling pathway     100989221 (RRAS)    04072 Phospholipase D signaling pathway     100989221 (RRAS)    04024 cAMP signaling pathway     100989221 (RRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     100989221 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100989221 (RRAS)    04137 Mitophagy - animal     100989221 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     100989221 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100989221 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100989221 (RRAS)   09158 Development and regeneration    04360 Axon guidance     100989221 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100989221 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     100989221 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pps04031]     100989221 (RRAS) GTP-binding proteins [BR:pps04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100989221 (RRAS) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  100989221 NCBI-ProteinID:  XP_034802422 LinkDB All DBs Position 20:complement(55752559..55757421) Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcgggggacctggg cccggggaccccccgccaagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc actattgaggactcctacacgaagatctgcagtgtggatggcatcccagcccggctggac atcctggacaccgcgggccaggaagagttcggggccatgagagagcagtacatgcgtgct ggccacggcttcctgctggtgttcgccattaacgaccggcagagtttcaacgaggtgggc aagctcttcacgcagattctgcgggtcaaggaccgcgacgacttccccgttgtgttggtc gggaacaaggcagatctggagtcacagcgccaggtcccccgatcagaagcctctgccttc ggcgcctcccaccacgtggcctactttgaggcctcggccaaactgcgtctcaacgtggac gaggcttttgagcagctggtgcgggccgtccggaaataccaggaacaagagctcccaccg agccctcccagtgcccccaggaagaagggcgggggctgcccctgcgtcctcctgtag

DBGET integrated database retrieval system