Pan paniscus (bonobo): 100989221 Help Entry 100989221         CDS       T02283                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism pps  Pan paniscus (bonobo) Pathway pps04010   MAPK signaling pathway pps04014   Ras signaling pathway pps04015   Rap1 signaling pathway pps04024   cAMP signaling pathway pps04072   Phospholipase D signaling pathway pps04137   Mitophagy - animal pps04140   Autophagy - animal pps04218   Cellular senescence pps04360   Axon guidance pps04371   Apelin signaling pathway pps04625   C-type lectin receptor signaling pathway pps04810   Regulation of actin cytoskeleton pps05132   Salmonella infection pps05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100989221 (RRAS)    04015 Rap1 signaling pathway     100989221 (RRAS)    04072 Phospholipase D signaling pathway     100989221 (RRAS)    04024 cAMP signaling pathway     100989221 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100989221 (RRAS)    04137 Mitophagy - animal     100989221 (RRAS)  09150 Organismal Systems   09158 Development and regeneration    04360 Axon guidance     100989221 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100989221 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pps04031]     100989221 (RRAS) GTP-binding proteins [BR:pps04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100989221 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  100989221 NCBI-ProteinID:  XP_034802422 LinkDB All DBs Position 20:complement(55752559..55757421) Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcgggggacctggg cccggggaccccccgccaagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc actattgaggactcctacacgaagatctgcagtgtggatggcatcccagcccggctggac atcctggacaccgcgggccaggaagagttcggggccatgagagagcagtacatgcgtgct ggccacggcttcctgctggtgttcgccattaacgaccggcagagtttcaacgaggtgggc aagctcttcacgcagattctgcgggtcaaggaccgcgacgacttccccgttgtgttggtc gggaacaaggcagatctggagtcacagcgccaggtcccccgatcagaagcctctgccttc ggcgcctcccaccacgtggcctactttgaggcctcggccaaactgcgtctcaacgtggac gaggcttttgagcagctggtgcgggccgtccggaaataccaggaacaagagctcccaccg agccctcccagtgcccccaggaagaagggcgggggctgcccctgcgtcctcctgtag

DBGET integrated database retrieval system