Pan paniscus (bonobo): 100989491 Help Entry 100989491         CDS       T02283                                  Symbol FGF6 Name (RefSeq) fibroblast growth factor 6   KO K04358   fibroblast growth factor Organism pps  Pan paniscus (bonobo) Pathway pps04010   MAPK signaling pathway pps04014   Ras signaling pathway pps04015   Rap1 signaling pathway pps04020   Calcium signaling pathway pps04151   PI3K-Akt signaling pathway pps04810   Regulation of actin cytoskeleton pps05200   Pathways in cancer pps05207   Chemical carcinogenesis - receptor activation pps05218   Melanoma pps05224   Breast cancer pps05226   Gastric cancer Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100989491 (FGF6)    04014 Ras signaling pathway     100989491 (FGF6)    04015 Rap1 signaling pathway     100989491 (FGF6)    04020 Calcium signaling pathway     100989491 (FGF6)    04151 PI3K-Akt signaling pathway     100989491 (FGF6)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100989491 (FGF6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100989491 (FGF6)    05207 Chemical carcinogenesis - receptor activation     100989491 (FGF6)   09162 Cancer: specific types    05226 Gastric cancer     100989491 (FGF6)    05218 Melanoma     100989491 (FGF6)    05224 Breast cancer     100989491 (FGF6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100989491 (FGF6)    00536 Glycosaminoglycan binding proteins [BR:pps00536]     100989491 (FGF6) Cytokines and neuropeptides [BR:pps04052]  Cytokines   Growth factors (RTK binding)    100989491 (FGF6) Glycosaminoglycan binding proteins [BR:pps00536]  Heparan sulfate / Heparin   Growth factors/receptors    100989491 (FGF6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  100989491 NCBI-ProteinID:  XP_003820386 Ensembl:  ENSPPAG00000040628 UniProt:  A0A2R9C1N8 LinkDB All DBs Position 10:complement(9973565..9986599) Genome browser AA seq 208 aa AA seqDB search MALGQKLFITMSRGAGHLQGTLWALVFLGILVGMVVPSPAGTRANNTLLDSRGWGTLLSR SRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGRISGTHEENPYSLLEI STVERGVVSLFGVRSALFVAMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYRGTY IALSKYGRVKRGSKVSPIMTVTHFLPRI NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggccctgggacagaaactgttcatcactatgtcccggggagcaggacatctgcagggc acgctgtgggctctcgtcttcctaggcatcctagtgggcatggtggtgccctcgcctgca ggcacccgtgccaacaacacgctgctggactcgaggggctggggcaccctgctgtccagg tctcgcgccgggctagctggagagatcgccggggtgaactgggaaagtggctatttggtg gggatcaagcggcagcggaggctctactgcaacgtgggcattggctttcacctccaggtg ctccccgacggccggatcagcgggacccacgaggagaacccctacagcctgctggaaatt tccaccgtggagcgaggcgtggtgagtctctttggagtgagaagtgccctcttcgttgcc atgaacagtaaaggaagattgtacgcaacgcccagcttccaagaagaatgcaagttcaga gaaaccctcctgcccaacaattacaatgcctacgagtcagacttgtaccgagggacctac atcgccctgagcaaatacggacgggtaaagcggggcagcaaggtgtccccgatcatgact gtcactcatttccttcccaggatctaa

DBGET integrated database retrieval system