Pan paniscus (bonobo): 100989787 Help Entry 100989787         CDS       T02283                                  Symbol IL13 Name (RefSeq) interleukin-13 isoform X1   KO K05435   interleukin 13 Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04630   JAK-STAT signaling pathway pps04657   IL-17 signaling pathway pps04658   Th1 and Th2 cell differentiation pps04664   Fc epsilon RI signaling pathway pps05200   Pathways in cancer pps05310   Asthma pps05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100989787 (IL13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100989787 (IL13)  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     100989787 (IL13)    04657 IL-17 signaling pathway     100989787 (IL13)    04664 Fc epsilon RI signaling pathway     100989787 (IL13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100989787 (IL13)   09163 Immune disease    05310 Asthma     100989787 (IL13)    05321 Inflammatory bowel disease     100989787 (IL13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100989787 (IL13) Cytokines and neuropeptides [BR:pps04052]  Cytokines   Interleukins    100989787 (IL13) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL13 Motif Other DBs NCBI-GeneID:  100989787 NCBI-ProteinID:  XP_003829348 Ensembl:  ENSPPAG00000030757 UniProt:  A0A2R9AD95 LinkDB All DBs Position 4:127968733..127973681 Genome browser AA seq 170 aa AA seqDB search MVSGVTTWAYKSCHKTPRPQATQPMRPLLNPLLLALGLMALLLTTVIALTCLGGFASPGP VPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKT QRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggtgtcaggcgtcaccacttgggcctataaaagctgccacaagacgccaaggccacaa gccacccagcctatgcgtccgctcctcaatcctctcctgttggcactgggcctcatggcg cttttgttgaccacggtcattgctctcacttgccttggcggctttgcctccccaggccct gtgcctccctctacagccctcagggagctcattgaggagctggtcaacatcacccagaac cagaaggctccgctctgcaatggcagcatggtatggagcatcaacctgacagctggcgtg tactgtgcagccctggaatccctgatcaacgtgtcaggctgcagtgccatcgagaagacc cagaggatgctgagcggattctgcccgcacaaggtctcagctgggcagttttccagcttg catgtccgagacaccaaaatcgaggtggcccagtttgtaaaggacctgctcttacattta aagaaactttttcgcgagggacggttcaactga

DBGET integrated database retrieval system