KEGG   Pan paniscus (bonobo): 100990801
Entry
100990801         CDS       T02283                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04062  Chemokine signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04137  Mitophagy - animal
pps04140  Autophagy - animal
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04218  Cellular senescence
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04625  C-type lectin receptor signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04714  Thermogenesis
pps04720  Long-term potentiation
pps04722  Neurotrophin signaling pathway
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04730  Long-term depression
pps04810  Regulation of actin cytoskeleton
pps04910  Insulin signaling pathway
pps04912  GnRH signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04917  Prolactin signaling pathway
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04926  Relaxin signaling pathway
pps04929  GnRH secretion
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps04960  Aldosterone-regulated sodium reabsorption
pps05010  Alzheimer disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05034  Alcoholism
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05207  Chemical carcinogenesis - receptor activation
pps05208  Chemical carcinogenesis - reactive oxygen species
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05216  Thyroid cancer
pps05218  Melanoma
pps05219  Bladder cancer
pps05220  Chronic myeloid leukemia
pps05221  Acute myeloid leukemia
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100990801 (KRAS)
   04012 ErbB signaling pathway
    100990801 (KRAS)
   04014 Ras signaling pathway
    100990801 (KRAS)
   04015 Rap1 signaling pathway
    100990801 (KRAS)
   04370 VEGF signaling pathway
    100990801 (KRAS)
   04371 Apelin signaling pathway
    100990801 (KRAS)
   04068 FoxO signaling pathway
    100990801 (KRAS)
   04072 Phospholipase D signaling pathway
    100990801 (KRAS)
   04071 Sphingolipid signaling pathway
    100990801 (KRAS)
   04151 PI3K-Akt signaling pathway
    100990801 (KRAS)
   04150 mTOR signaling pathway
    100990801 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100990801 (KRAS)
   04137 Mitophagy - animal
    100990801 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    100990801 (KRAS)
   04218 Cellular senescence
    100990801 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100990801 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    100990801 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100990801 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100990801 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    100990801 (KRAS)
   04660 T cell receptor signaling pathway
    100990801 (KRAS)
   04662 B cell receptor signaling pathway
    100990801 (KRAS)
   04664 Fc epsilon RI signaling pathway
    100990801 (KRAS)
   04062 Chemokine signaling pathway
    100990801 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100990801 (KRAS)
   04929 GnRH secretion
    100990801 (KRAS)
   04912 GnRH signaling pathway
    100990801 (KRAS)
   04915 Estrogen signaling pathway
    100990801 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    100990801 (KRAS)
   04917 Prolactin signaling pathway
    100990801 (KRAS)
   04921 Oxytocin signaling pathway
    100990801 (KRAS)
   04926 Relaxin signaling pathway
    100990801 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    100990801 (KRAS)
   04919 Thyroid hormone signaling pathway
    100990801 (KRAS)
   04916 Melanogenesis
    100990801 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100990801 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    100990801 (KRAS)
   04726 Serotonergic synapse
    100990801 (KRAS)
   04720 Long-term potentiation
    100990801 (KRAS)
   04730 Long-term depression
    100990801 (KRAS)
   04722 Neurotrophin signaling pathway
    100990801 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    100990801 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    100990801 (KRAS)
   04213 Longevity regulating pathway - multiple species
    100990801 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    100990801 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100990801 (KRAS)
   05206 MicroRNAs in cancer
    100990801 (KRAS)
   05205 Proteoglycans in cancer
    100990801 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    100990801 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    100990801 (KRAS)
   05203 Viral carcinogenesis
    100990801 (KRAS)
   05230 Central carbon metabolism in cancer
    100990801 (KRAS)
   05231 Choline metabolism in cancer
    100990801 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100990801 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100990801 (KRAS)
   05212 Pancreatic cancer
    100990801 (KRAS)
   05225 Hepatocellular carcinoma
    100990801 (KRAS)
   05226 Gastric cancer
    100990801 (KRAS)
   05214 Glioma
    100990801 (KRAS)
   05216 Thyroid cancer
    100990801 (KRAS)
   05221 Acute myeloid leukemia
    100990801 (KRAS)
   05220 Chronic myeloid leukemia
    100990801 (KRAS)
   05218 Melanoma
    100990801 (KRAS)
   05211 Renal cell carcinoma
    100990801 (KRAS)
   05219 Bladder cancer
    100990801 (KRAS)
   05215 Prostate cancer
    100990801 (KRAS)
   05213 Endometrial cancer
    100990801 (KRAS)
   05224 Breast cancer
    100990801 (KRAS)
   05223 Non-small cell lung cancer
    100990801 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100990801 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    100990801 (KRAS)
   05161 Hepatitis B
    100990801 (KRAS)
   05160 Hepatitis C
    100990801 (KRAS)
   05163 Human cytomegalovirus infection
    100990801 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100990801 (KRAS)
   05165 Human papillomavirus infection
    100990801 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100990801 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    100990801 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    100990801 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100990801 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100990801 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100990801 (KRAS)
   01522 Endocrine resistance
    100990801 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100990801 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pps04031]
    100990801 (KRAS)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100990801 (KRAS)
GTP-binding proteins [BR:pps04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100990801 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 100990801
NCBI-ProteinID: XP_034792052
Ensembl: ENSPPAG00000038418
UniProt: A0A2R9BMS1
LinkDB
Position
10:71565722..71611563
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcattttgtggacgaatatgatccaacaatagaggattcctac
aggaagcaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagttaaggactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattataatgtaa

DBGET integrated database retrieval system