Pan paniscus (bonobo): 100991964 Help Entry 100991964         CDS       T02283                                  Name (RefSeq) C-C motif chemokine 4 isoform X1   KO K12964   C-C motif chemokine 4 Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04061   Viral protein interaction with cytokine and cytokine receptor pps04062   Chemokine signaling pathway pps04064   NF-kappa B signaling pathway pps04620   Toll-like receptor signaling pathway pps04623   Cytosolic DNA-sensing pathway pps05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100991964   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100991964    04061 Viral protein interaction with cytokine and cytokine receptor     100991964  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100991964    04623 Cytosolic DNA-sensing pathway     100991964    04062 Chemokine signaling pathway     100991964  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100991964  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100991964 Cytokines and neuropeptides [BR:pps04052]  Cytokines   Chemokines    100991964 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100991964 NCBI-ProteinID:  XP_003818008 Ensembl:  ENSPPAG00000014523 UniProt:  A0A2R8ZL15 LinkDB All DBs Position 19:26786412..26789022 Genome browser AA seq 92 aa AA seqDB search MKLCMTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTAKKLPRNFVVDYYETSSLCSQ PAVVFQTKRGKQVCADPSESWVQEYVYDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcatgactgtcctgtctctcctcatgctagtagctgccttctgctctcca gcactctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgcg aagaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag ccagctgtggtattccaaaccaaaagaggcaagcaagtctgcgctgaccccagtgagtcc tgggtccaggagtacgtgtatgacctggaactgaactga

DBGET integrated database retrieval system