Pan paniscus (bonobo): 100992816 Help Entry 100992816         CDS       T02283                                  Symbol CAV2 Name (RefSeq) caveolin-2 isoform X1   KO K12958   caveolin 2 Organism pps  Pan paniscus (bonobo) Pathway pps04144   Endocytosis pps04510   Focal adhesion pps05020   Prion disease pps05100   Bacterial invasion of epithelial cells pps05205   Proteoglycans in cancer pps05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100992816 (CAV2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100992816 (CAV2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100992816 (CAV2)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100992816 (CAV2)   09164 Neurodegenerative disease    05020 Prion disease     100992816 (CAV2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100992816 (CAV2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pps04131]     100992816 (CAV2) Membrane trafficking [BR:pps04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     100992816 (CAV2) SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  100992816 NCBI-ProteinID:  XP_003808703 Ensembl:  ENSPPAG00000042201 UniProt:  A0A2R9CAM3 LinkDB All DBs Position 6:153331617..153340521 Genome browser AA seq 162 aa AA seqDB search MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEP VTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK TCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggggctggagacggagaaggcggacgtacagctcttcatggacgacgactcctacagc caccacagcggcctcgagtacgccgaccccgagaagttcgcggactcggaccaggaccgg gatccccaccggctcaactcgcatctcaagctgggcttcgaggatgtgatcgcagagccg gtgactacgcactcctttgacaaagtgtggatctgcagccatgccctctttgaaatcagc aaatacgtaatgtacaagttcctgacggtgttcctggccattcctctggccttcattgcg ggaattctctttgccaccctcagctgtctgcacatctggattttaatgccttttgtaaag acctgcctaatggttctgccttcagtgcagacaatatggaagagtgtgacagatgttatc attgctccattgtgtacgagcgtaggacgatgcttctcttctgtcagcctgcaactgagc caggattga

DBGET integrated database retrieval system