Pan paniscus (bonobo): 100994395 Help Entry 100994395         CDS       T02283                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism pps  Pan paniscus (bonobo) Pathway pps04066   HIF-1 signaling pathway pps04120   Ubiquitin mediated proteolysis pps05170   Human immunodeficiency virus 1 infection pps05200   Pathways in cancer pps05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:pps00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100994395  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     100994395  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100994395   09162 Cancer: specific types    05211 Renal cell carcinoma     100994395   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100994395  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pps04121]     100994395    03400 DNA repair and recombination proteins [BR:pps03400]     100994395 Ubiquitin system [BR:pps04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      100994395    Cul5 complex      100994395 DNA repair and recombination proteins [BR:pps03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      100994395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  100994395 NCBI-ProteinID:  XP_003819916 LinkDB All DBs Position 9:complement(130712809..130715006) Genome browser AA seq 145 aa AA seqDB search MPGGARAAGNGAERGRAGAAKGETAAAMDVFLVIRRRKTTIFTDAKESSTVFELKRVVEG ILKRPPDEQRLYKDYQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDAFEALCIQPF SSPPELLDVMKPQESGSSANEQAVQ NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgccgggaggcgcgcgggctgcagggaacggggcggagcgcggccgcgccggcgcagcg aagggagagacggcagccgctatggacgtgttcctcgtgatccggcgccgcaagaccacc atcttcactgacgccaaggagtccagcacggtgttcgagctgaagcgcgtcgtggaggga atcctcaagcggccgcccgacgagcagcggctgtacaaggactaccaactcttggatgat ggcaagacactgggcgagtgtggcttcaccagccaaacggcacggccgcaggccccagcc acagtggggctggccttccgggcagacgacgcctttgaggccctgtgcatccagccgttc tccagcccgcccgagctgctcgacgtgatgaagccccaggagtcgggaagcagtgccaat gaacaagctgtgcagtga

DBGET integrated database retrieval system