Pan paniscus (bonobo): 100994866 Help Entry 100994866         CDS       T02283                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism pps  Pan paniscus (bonobo) Pathway pps04015   Rap1 signaling pathway pps04810   Regulation of actin cytoskeleton pps05014   Amyotrophic lateral sclerosis pps05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100994866 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100994866 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100994866 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100994866 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pps04131]     100994866 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pps04812]     100994866 (PFN3)    04147 Exosome [BR:pps04147]     100994866 (PFN3) Membrane trafficking [BR:pps04131]  Others   Actin-binding proteins    Others     100994866 (PFN3) Cytoskeleton proteins [BR:pps04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100994866 (PFN3) Exosome [BR:pps04147]  Exosomal proteins   Proteins found in most exosomes    100994866 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100994866 NCBI-ProteinID:  XP_003806909 Ensembl:  ENSPPAG00000018574 UniProt:  A0A2R8ZI35 LinkDB All DBs Position 4:complement(172484293..172484845) Genome browser AA seq 137 aa AA seqDB search MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFL QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGI LNKTVHELIRGLRMQGA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaggtctacatcagtgcagtgctgcgggaccagcgcatcgacgacgtg gccatcgtgggccatgcggacaacagctgcgtgtgggcttcgcggcccgggggcctgctg gcggccatctcgccgcaggaggtgggcgtgctcacggggccggacaggcacaccttcctg caggcgggcctgagcgtggggggccgccgctgctgcgtcatccgagaccacctcctggcc gagggtgacggcgtgctggacgcacgcaccaaggggctggacgcgcgcgccgtgtgcgtg ggccgtgcgccgcgcgcgctcctggtgctaatgggccgacgcggcgtacatgggggcatc ctcaacaagacggtgcacgaactcatacgcgggctgcgcatgcagggcgcctag

DBGET integrated database retrieval system