Pan paniscus (bonobo): 100995767 Help Entry 100995767         CDS       T02283                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism pps  Pan paniscus (bonobo) Pathway pps04010   MAPK signaling pathway pps04020   Calcium signaling pathway pps04022   cGMP-PKG signaling pathway pps04114   Oocyte meiosis pps04218   Cellular senescence pps04310   Wnt signaling pathway pps04360   Axon guidance pps04370   VEGF signaling pathway pps04380   Osteoclast differentiation pps04625   C-type lectin receptor signaling pathway pps04650   Natural killer cell mediated cytotoxicity pps04658   Th1 and Th2 cell differentiation pps04659   Th17 cell differentiation pps04660   T cell receptor signaling pathway pps04662   B cell receptor signaling pathway pps04720   Long-term potentiation pps04724   Glutamatergic synapse pps04921   Oxytocin signaling pathway pps04922   Glucagon signaling pathway pps04924   Renin secretion pps05010   Alzheimer disease pps05014   Amyotrophic lateral sclerosis pps05020   Prion disease pps05022   Pathways of neurodegeneration - multiple diseases pps05031   Amphetamine addiction pps05152   Tuberculosis pps05163   Human cytomegalovirus infection pps05166   Human T-cell leukemia virus 1 infection pps05167   Kaposi sarcoma-associated herpesvirus infection pps05170   Human immunodeficiency virus 1 infection pps05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pps05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100995767 (PPP3R2)    04310 Wnt signaling pathway     100995767 (PPP3R2)    04370 VEGF signaling pathway     100995767 (PPP3R2)    04020 Calcium signaling pathway     100995767 (PPP3R2)    04022 cGMP-PKG signaling pathway     100995767 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100995767 (PPP3R2)    04218 Cellular senescence     100995767 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100995767 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     100995767 (PPP3R2)    04660 T cell receptor signaling pathway     100995767 (PPP3R2)    04658 Th1 and Th2 cell differentiation     100995767 (PPP3R2)    04659 Th17 cell differentiation     100995767 (PPP3R2)    04662 B cell receptor signaling pathway     100995767 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     100995767 (PPP3R2)    04921 Oxytocin signaling pathway     100995767 (PPP3R2)    04924 Renin secretion     100995767 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     100995767 (PPP3R2)    04720 Long-term potentiation     100995767 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     100995767 (PPP3R2)    04380 Osteoclast differentiation     100995767 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100995767 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100995767 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     100995767 (PPP3R2)    05163 Human cytomegalovirus infection     100995767 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     100995767 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     100995767 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     100995767 (PPP3R2)    05014 Amyotrophic lateral sclerosis     100995767 (PPP3R2)    05020 Prion disease     100995767 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     100995767 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     100995767 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100995767 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pps01009]     100995767 (PPP3R2) Protein phosphatases and associated proteins [BR:pps01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100995767 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH EF-hand_9 YtfJ_HI0045 flgK_1st_1 Motif Other DBs NCBI-GeneID:  100995767 NCBI-ProteinID:  XP_054973775 LinkDB All DBs Position 11:37766051..37775517 Genome browser AA seq 173 aa AA seqDB search MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRR VIDVFDTDGDGEVDFKEFILGTSQFSVKGNEEQKLRFAFSIYDMDKDGYISNGELFQVLK MMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtccacaatgggaaacgaggccagttacccggcggagatgtgctcccactttgacaat gatgaaattaaaaggctgggcaggaggtttaagaagttggacttggacaaatcagggtct ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga gtgatcgacgtcttcgacaccgacggtgatggagaagtggacttcaaggaattcatcctg gggacctcccagttcagcgtcaagggcaacgaggagcagaagttgaggtttgcgttcagc atttacgacatggataaagatggctacatttccaacggggagctcttccaggtgctgaag atgatggtgggcaacaacctgacggactggcagctccagcagctggtcgacaaaaccatc atcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc agagacctggagatccacaagaagctggtcctcatcgtgtga

DBGET integrated database retrieval system