Pan paniscus (bonobo): 103783901 Help Entry 103783901         CDS       T02283                                  Name (RefSeq) metallothionein-1L   KO K14739   metallothionein 1/2 Organism pps  Pan paniscus (bonobo) Pathway pps04978   Mineral absorption Brite KEGG Orthology (KO) [BR:pps00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     103783901  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pps03019]     103783901    03029 Mitochondrial biogenesis [BR:pps03029]     103783901 Messenger RNA biogenesis [BR:pps03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      103783901 Mitochondrial biogenesis [BR:pps03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     103783901 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  103783901 NCBI-ProteinID:  XP_008955628 LinkDB All DBs Position 21:40950819..40959629 Genome browser AA seq 52 aa AA seqDB search MDPNCSCTTGGSCKCKECKCTSCKKSCCSCCPMGCAKCAQGCVCKGACSCCV NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcaccactggtggctcctgcaagtgcaaagagtgcaaatgc acctcctgcaagaagagctgctgctcctgctgccccatgggctgtgccaagtgtgcccag ggctgtgtctgcaaaggggcgtgcagctgctgtgtctga

DBGET integrated database retrieval system