Pan paniscus (bonobo): 112438809 Help Entry 112438809         CDS       T02283                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism pps  Pan paniscus (bonobo) Pathway pps04613   Neutrophil extracellular trap formation pps05034   Alcoholism pps05203   Viral carcinogenesis pps05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pps00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112438809  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     112438809   09163 Immune disease    05322 Systemic lupus erythematosus     112438809   09165 Substance dependence    05034 Alcoholism     112438809  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pps03036]     112438809 Chromosome and associated proteins [BR:pps03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112438809 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  112438809 NCBI-ProteinID:  XP_063461742 LinkDB All DBs Position 1:complement(99998740..100012209) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtccggcagaggaaagggcggaaaaggcttaggcaaagggggcgctaagcgccaccgc aaggtcttgagagacaacattcagggcatcaccaagcctgccattcggcgtctagctcgg cgtggcggcgttaagcggatctctggcctcatttacgaggagacccgcggtgtgctgaag gtgttcctggagaatgtgattcgggacgcagtcacctacaccgagcacgccaagcgcaag accgtcacagccatggatgtggtgtacgcgctcaagcgccaggggcgcaccctgtacggc ttcggaggctag

DBGET integrated database retrieval system