Pan paniscus (bonobo): 117976443 Help Entry 117976443         CDS       T02283                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04061   Viral protein interaction with cytokine and cytokine receptor pps04062   Chemokine signaling pathway pps04620   Toll-like receptor signaling pathway pps05142   Chagas disease pps05163   Human cytomegalovirus infection pps05323   Rheumatoid arthritis pps05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     117976443    04061 Viral protein interaction with cytokine and cytokine receptor     117976443  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     117976443    04062 Chemokine signaling pathway     117976443  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     117976443   09174 Infectious disease: parasitic    05142 Chagas disease     117976443   09163 Immune disease    05323 Rheumatoid arthritis     117976443   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     117976443  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     117976443    00536 Glycosaminoglycan binding proteins [BR:pps00536]     117976443 Cytokines and neuropeptides [BR:pps04052]  Cytokines   Chemokines    117976443 Glycosaminoglycan binding proteins [BR:pps00536]  Heparan sulfate / Heparin   Chemokines    117976443 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  117976443 NCBI-ProteinID:  XP_063454680 LinkDB All DBs Position 19:52872758..52878812 Genome browser AA seq 81 aa AA seqDB search MEEYEAHCLPFSTVAADTPTACCFSYISRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQ VCADPSEEWVQKYVSDLELSA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggaagaatatgaagctcattgtcttcctttctccacagttgctgccgacacgccgacc gcctgctgcttcagctacatctcccggcagattccacagaatttcatagctgactacttt gagaccagcagccagtgctccaagcccagtgttatcttcctaaccaagagaggccggcag gtctgtgctgaccccagtgaggagtgggtccagaaatatgtcagcgacctggagctgagt gcctga

DBGET integrated database retrieval system