Pan paniscus (bonobo): 117977141 Help Entry 117977141         CDS       T02283                                  Symbol OXT Name (RefSeq) oxytocin-neurophysin 1   KO K05243   oxytocin-neurophysin 1 Organism pps  Pan paniscus (bonobo) Pathway pps04024   cAMP signaling pathway pps04080   Neuroactive ligand-receptor interaction pps04081   Hormone signaling pps04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     117977141 (OXT)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     117977141 (OXT)    04081 Hormone signaling     117977141 (OXT)  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     117977141 (OXT)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     117977141 (OXT) Cytokines and neuropeptides [BR:pps04052]  Neuropeptides   GPCR binding    117977141 (OXT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_5 Hormone_4 Motif Other DBs NCBI-GeneID:  117977141 NCBI-ProteinID:  XP_054960739 LinkDB All DBs Position 21:4039169..4040042 Genome browser AA seq 125 aa AA seqDB search MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCA EELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDMEA TFSQH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggccggccccagcctcgcttgctgtctgctgggcctcctggcgctgacctccgcctgc tacatccagaactgccccctgggaggcaagagggccgcgccggacctcgacgtgcgcaag tgcctcccctgcggccccgggggcaaaggccgctgcttcgggcccaatatctgctgcgcg gaagagctgggctgcttcgtgggcaccgccgaagcgctgcgctgccaggaggagaactac ctgccgtcgccctgccagtccggccagaaggcgtgcgggagcgggggccgctgcgcggtc ttgggcctctgctgcagcccggacggctgccacgccgaccccgcctgcgacatggaagct accttctcccagcactga

DBGET integrated database retrieval system