Pan paniscus (bonobo): 117981650 Help Entry 117981650         CDS       T02283                                  Name (RefSeq) interferon alpha-17   KO K05414   interferon alpha Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04151   PI3K-Akt signaling pathway pps04217   Necroptosis pps04620   Toll-like receptor signaling pathway pps04621   NOD-like receptor signaling pathway pps04622   RIG-I-like receptor signaling pathway pps04623   Cytosolic DNA-sensing pathway pps04630   JAK-STAT signaling pathway pps04650   Natural killer cell mediated cytotoxicity pps04936   Alcoholic liver disease pps05152   Tuberculosis pps05160   Hepatitis C pps05161   Hepatitis B pps05162   Measles pps05163   Human cytomegalovirus infection pps05164   Influenza A pps05165   Human papillomavirus infection pps05167   Kaposi sarcoma-associated herpesvirus infection pps05168   Herpes simplex virus 1 infection pps05169   Epstein-Barr virus infection pps05170   Human immunodeficiency virus 1 infection pps05171   Coronavirus disease - COVID-19 pps05200   Pathways in cancer pps05320   Autoimmune thyroid disease pps05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     117981650    04151 PI3K-Akt signaling pathway     117981650   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     117981650  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     117981650  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     117981650    04621 NOD-like receptor signaling pathway     117981650    04622 RIG-I-like receptor signaling pathway     117981650    04623 Cytosolic DNA-sensing pathway     117981650    04650 Natural killer cell mediated cytotoxicity     117981650  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     117981650   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     117981650    05161 Hepatitis B     117981650    05160 Hepatitis C     117981650    05171 Coronavirus disease - COVID-19     117981650    05164 Influenza A     117981650    05162 Measles     117981650    05168 Herpes simplex virus 1 infection     117981650    05163 Human cytomegalovirus infection     117981650    05167 Kaposi sarcoma-associated herpesvirus infection     117981650    05169 Epstein-Barr virus infection     117981650    05165 Human papillomavirus infection     117981650   09171 Infectious disease: bacterial    05152 Tuberculosis     117981650   09163 Immune disease    05320 Autoimmune thyroid disease     117981650   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     117981650   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     117981650  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     117981650 Cytokines and neuropeptides [BR:pps04052]  Cytokines   Interferons    117981650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon iSTAND Motif Other DBs NCBI-GeneID:  117981650 NCBI-ProteinID:  XP_034823120 LinkDB All DBs Position 11:103360024..103361329 Genome browser AA seq 189 aa AA seqDB search MALSFSLLMAVLVLSYKSICSLGCDLPQTHNLGNRRALILLAQMGRISPFSCLKDRHDFG FPQEEFDGNQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTERKYSPCAWEVVRAEIMRSLSFSTN LQKRLRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt tctctgggctgtgatctgcctcagacccacaacctgggtaataggagggccttgatactc ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgatttcgga ttcccccaggaggagtttgatggcaaccagttccagaagactcaagccatctctgtcctc catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa gcatgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc ctggctgtgaggaaatacttccaaagaatcactctttatctaacagagaggaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctcgttttcaacaaac ttgcaaaaaagattaaggaggaaggattga

DBGET integrated database retrieval system