Pan paniscus (bonobo): 129393796 Help Entry 129393796         CDS       T02283                                  Name (RefSeq) metallothionein-1X   KO K14739   metallothionein 1/2 Organism pps  Pan paniscus (bonobo) Pathway pps04978   Mineral absorption Brite KEGG Orthology (KO) [BR:pps00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     129393796  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pps03019]     129393796    03029 Mitochondrial biogenesis [BR:pps03029]     129393796 Messenger RNA biogenesis [BR:pps03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      129393796 Mitochondrial biogenesis [BR:pps03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     129393796 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  129393796 NCBI-ProteinID:  XP_054953456 LinkDB All DBs Position 15:37748695..37749088 Genome browser AA seq 61 aa AA seqDB search MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgctcgcctgttggctcctgtgcctgtgccggctcctgcaaa tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccctgtgggc tgtgccaagtgtgcccagggctgcatctgcaaagggacgtcagacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system